KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3328Help
Entry
I33_3328          CDS       T01837                                 

Definition
(GenBank) phosphatidylglycerophosphatase A
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA DUF4258 Swi3
Motif
Other DBs
NCBI-ProteinID: AEP92244
LinkDB All DBs
Position
3113480..3113980
Genome map
AA seq 166 aa AA seqDB search
MSENEQFSQMEAKARARMKERGVEVSDIAELVFFLQKKYHPDLTIDECTLNVNRVLAKRE
VQNAILTGIELDVLAEQKKLSEPLQTMLEIDESLYGVDEVLAFSIVNIYGSIGFTNYGYI
DKEKPGILKRLNDKSTGECHTFLDDIVGAISAAASSRLAHRARHTE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaacgaacaattcagtcagatggaagctaaagcaagagcacggatgaaggag
cgcggcgttgaggtatcggacattgccgagcttgtcttttttctgcagaaaaaatatcat
ccggatttaaccattgatgaatgcacgctgaacgtcaatcgtgttctcgcaaaacgcgag
gtgcaaaacgcgattttaacgggcattgaattggatgttcttgctgagcagaaaaaactg
tctgaaccgctgcaaacgatgctggaaatagatgaaagcctatatggagtagatgaagtt
ctggcattttccattgtgaacatttacggatcgatcgggtttacgaactacggttacatc
gacaaagaaaaacccggaatccttaaacgattgaatgataaatcaaccggtgaatgccat
acttttttagatgacatcgtcggagcgatttccgccgcggcttccagcagactcgcacac
cgcgcgcggcatacagaataa

DBGET integrated database retrieval system