KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3399Help
Entry
I33_3399          CDS       T01837                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00061  Fatty acid biosynthesis
bsr00780  Biotin metabolism
bsr01100  Metabolic pathways
bsr01130  Biosynthesis of antibiotics
bsr01212  Fatty acid metabolism
Module
bsr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    I33_3399
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    I33_3399
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    I33_3399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsr01004]
    I33_3399
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     I33_3399
Lipid biosynthesis proteins [BR:bsr01004]
 Fatty acid synthase
  Component type
   I33_3399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase THF_DHG_CYH_C LDcluster4 YjeF_N PAD_M Pox_TAA1
Motif
Other DBs
NCBI-ProteinID: AEP92315
LinkDB All DBs
Position
complement(3174563..3175303)
Genome map
AA seq 246 aa AA seqDB search
MNVLNKIALVTGGGTGIGKAASMELAKRGAIVAVNYSRSQSEAEETVEIIKKAGGQAFAI
QADVSKNSEVQDMVQTIVKTHGPIDVLVNNASITRHIPMGDLEAATEDVWDELYAVNVKG
MFFCARAVAPFMKKSKAGAIVNVGSIAGLTGAGSSMPYAVSKSAVHGLTKSLAHALAPEI
RVSGVAPGAVATRWWAGREEKMKSMIGSLPLQCIAEPDDVAKLICSLVEQESLTGQIITI
DSGQTL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcttgaacaaaatagctctcgtaacgggcggcggcacaggtatcggaaaagca
gccagtatggaattggcaaagcgcggggcgattgtggcagtgaattattcacgttcgcaa
tcagaagcggaggaaacagtggaaatcataaaaaaagctggcgggcaagccttcgccatt
caagcggatgtatccaaaaacagcgaagtgcaggatatggttcaaacaatcgtgaaaaca
cacggcccgattgatgttttagtcaacaatgccagcattacacggcatattccaatgggt
gatcttgaagctgcgacagaagacgtctgggatgagctgtacgccgtcaatgtgaaaggg
atgtttttctgcgcgagggcagtggctccgttcatgaagaaaagcaaggctggagcgatc
gtaaacgtcggcagcatcgcagggttaaccggtgcaggctcatctatgccttacgcagta
tcaaaatcggcggtgcacggtttaacgaaatcattggctcacgccttagcgcctgaaatc
agagtgagcggtgtagcaccaggagctgtggcaacgagatggtgggctggccgggaagaa
aaaatgaaaagcatgatcggctctttgccgctgcagtgtattgctgaaccagatgatgtt
gccaaattgatttgttcactagttgaacaggaatcactcacaggccaaattatcacaatt
gacagcggacagacgctgtaa

DBGET integrated database retrieval system