KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3401Help
Entry
I33_3401          CDS       T01837                                 

Definition
(GenBank) hypothetical protein
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 Terminase_2
Motif
Other DBs
NCBI-ProteinID: AEP92317
LinkDB All DBs
Position
complement(3176344..3176694)
Genome map
AA seq 116 aa AA seqDB search
MHCPGSGFHITWINNAAKELSIEKALCCFFERKMEMEQKLQEQLDGLLEKYTELLLGETN
DELKEEVKQWILYTHIAKSMPPLAKHWNATYPDAKQGIKEIIQHIKELNEAHRNKQ
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtccaggaagcggctttcacatcacatggataaataacgcagcgaaggagctt
tcaattgagaaagctctttgctgttttttcgaaaggaagatggaaatggaacaaaaactt
caggagcagctggatggattgctggagaagtatactgagcttctgcttggtgaaacaaac
gatgagctaaaagaagaagtgaagcaatggattttgtacacgcatatagccaagagcatg
cctccgctcgctaagcattggaatgcgacataccccgacgcaaagcagggcattaaagag
atcattcagcatattaaggaattaaatgaagcgcatcgaaataaacaatag

DBGET integrated database retrieval system