KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_02415Help
Entry
BSUW23_02415      CDS       T01302                                 

Gene name
alrA
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00473  D-Alanine metabolism
bss01100  Metabolic pathways
bss01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSUW23_02415 (alrA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BSUW23_02415 (alrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bss01011]
    BSUW23_02415 (alrA)
Enzymes [BR:bss01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSUW23_02415 (alrA)
Peptidoglycan biosynthesis and degradation proteins [BR:bss01011]
 Precursor biosynthesis
  Racemase
   BSUW23_02415 (alrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADM36541
UniProt: E0U3Q9
LinkDB All DBs
Position
505200..506369
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAG
ASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYAEIAAEYDLTLTGYSVEWLQEAARHM
KKGSLHFHLKVDTGMNRLGVKTEEEVHHVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKKMMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADITDEIPF
ELHPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTEILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVSCT
ISSRVPRMFLENGSIMEVRNPLLQENTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagagatacgtgggcggaaatcgacttgtccgcgataaaa
gaaaatgtcagcaacatgaaaaaacatatcggagaacatgtccacctgatggcagttgta
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggcggcgcttgacgcaggc
gcttcatgtttggccgtagctattttggatgaagcgatttcgctgcgcaagaagggcttg
aaggcgcctatattggtgctcggcgcggttcccccggagtatgcggaaatcgcggctgaa
tatgacctgacattaacaggttattctgttgaatggcttcaggaagccgcccgccacatg
aaaaaaggttctcttcattttcatttgaaggtcgatacggggatgaaccggctaggggta
aaaacggaagaagaagttcatcacgtgatggcgattcttgaccgcaacccccgtttaaaa
tgcaaaggggtatttactcattttgcgacagcggatgaaaaagaaagaggctatttttta
atgcagtttgagcgcttcaaagaactgattgctccgctcccgctaaaaaaaatgatggtc
cactgcgcgaacagcgccgccggccttcgtctgaaaaaaggctttttcaacgcggttaga
ttcggcattggcatgtacggcctccgtccgtcagccgacattacggatgaaataccgttt
gagctgcaccctgcgtttaccttgcattcgacgctatctcatgtcaaattgatcagaaaa
ggtgagagcgtcagctatggagcggaatacacagcggaaaaagacacatggatcgggacg
gtgcctgtcggctatgcggacggctggcttcgaaaattgaaaggaaccgagattcttgtg
aaaggtaagcggctgaaaatcgccggccgaatctgcatggaccaatttatggtggagctg
gatcaggaatatccgccaggcacaaaagtgacattaataggccggcaaggggatgaatac
atttccatggatgagattgcaggcaggctcgaaacgatcaactacgaggtgtcttgtaca
attagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggaaaatacaagcaaatag

DBGET integrated database retrieval system