KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_03105Help
Entry
BSUW23_03105      CDS       T01302                                 

Gene name
gutP
Definition
(GenBank) H+-glucitol symporter
  KO
K16248  probable glucitol transport protein GutA
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
KEGG Orthology (KO) [BR:bss00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bss02000]
    BSUW23_03105 (gutP)
Transporters [BR:bss02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSUW23_03105 (gutP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_2 MFS_1
Motif
Other DBs
NCBI-ProteinID: ADM36677
UniProt: E0TTJ6
LinkDB All DBs
Position
635726..637159
Genome map
AA seq 477 aa AA seqDB search
MFTGNENGFLGWEMMIETEKVTTLKAKHQSKSSTSLSWFERIGYGFGDMSYNIIFQFVNA
YLLFYYTDVGGIQPAVIATLFLVVRVLDAIFDPIMGLILDKTNTRWGKARPYLLWVAFPF
ALFTFLCFTTPHFGETGNMVYAYITYILLGMSFSMQTIPVNSLTGRMTNSVEERTVLTTT
RMILVYIGILLSISCATPLATAIGGEDQAFGFQMTALIYAAVSIVLNLFSFFTVRERIQP
KKRKKQGIKKTLSVLFRNKPLLMLVSSFLAFAIGFNIKLSTMVYYFTYNVNHKEFVFLGT
VLFFGAALISNLFIPFFSEKWGRKQVMMITAALSLISYAGLHFTPYSSITLIFIWLFVSG
FFTTPLNTLAWGMVADCVDYAEWKTGVRADGVVISSMSFINKLGVALAGSFSAIYLGIAG
YVANADQTVTSLNAIKNMNALIPGFFILLSIILIAFYPLTEKRYKHIISELEQRSAR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgttcactggaaatgaaaacggattcttggggtgggaaatgatgattgaaacagaaaaa
gtcacgacattgaaggcgaagcatcagtcaaaatccagcaccagcctgtcctggtttgaa
cgaatcggctatggattcggcgatatgtcgtataatattatctttcagtttgtaaacgca
tacctattattctattatacagacgtcggcggcattcagcctgcggtgattgcaactttg
tttcttgttgtgcgggtgctggatgctatttttgacccgatcatgggattgattttagac
aaaacgaatacaaggtggggaaaggcaaggccatatctgttgtgggtggcatttcctttt
gcgctttttacgttcctatgtttcacgacgcctcatttcggtgagacggggaatatggta
tatgcgtacatcacctatattctattggggatgtcctttagtatgcaaacgatcccggtg
aacagcttaacggggcgtatgacgaattctgttgaggaacgaacggttctgacaacaacc
cggatgattttggtgtatatcggaattcttttatccatttcctgtgcgacaccgcttgca
actgctatcggaggagaggatcaggcatttggatttcagatgacagcgctcatctatgcg
gcggtcagcatcgttttgaatctatttagtttctttactgtacgggagcggattcagcct
aaaaagagaaaaaaacaagggatcaaaaagacgttatccgttttattccgaaacaaacct
ttgctaatgttagtttcatcatttttggcttttgcgatcgggtttaatattaagcttagt
acgatggtgtactattttacgtataacgtaaatcataaggaattcgtgtttttgggaact
gttttattttttggagcagcgctgatcagcaatttgtttattcctttcttttctgagaag
tggggcagaaaacaagtgatgatgatcacggcagctctatcgcttatttcttatgccggc
ctgcattttacgccgtattcttccattacactcattttcatttggcttttcgtttcagga
tttttcacaacgcctttaaacacacttgcttgggggatggttgccgattgtgtcgattat
gcggaatggaagacaggggttcgtgccgacggagtagtgatttcgagcatgagctttatc
aataagctgggtgtggcgttagccgggtcattttcggccatctatttaggaatcgcagga
tatgtagcgaatgcagaccagacagttacgtcattgaatgcgattaaaaacatgaatgct
ttgattccgggatttttcattttgctatctattattctcatcgccttctatcctttaacg
gaaaaaagatataagcacatcatctctgagctggagcaaaggtctgccagataa

DBGET integrated database retrieval system