KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_03745Help
Entry
BSUW23_03745      CDS       T01302                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00627  Aminobenzoate degradation
bss01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSUW23_03745 (yfmT)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BSUW23_03745 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADM36805
UniProt: E0TUY7
LinkDB All DBs
Position
776357..777814
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFQKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIMKEAATFP
VRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLEMYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKSVEKAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHQK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacaatttatcggcgggaaatggcaggagggcagc
agcccaaatgtattagaaaacaaaaatccttatactcaaaaaacattcacaaccttccaa
aaagcgactgctgacgatgtagatgaagcgtaccgggcagcggcgctggcgaagaaaaaa
tgggatgcggtcaatccgtttgaaaaaagaaccattttagaaaaagccgtcacgtatatt
gaagagaacgaagaagccatcatttatttgattatggaggagcttggcggaacaaggctc
aaagcagcctttgaaatcgggcttgtcaaaaacattatgaaagaagcggcgacgttccct
gtccgcatggaaggaaaaattcttccgtcaacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagcccatttaacttcccattctttttatct
atgaaatcagtggcgcccgcgctcggagcaggcaatggcgtcgttttaaagccgcatgaa
gaaacaccgatttgcggcggtacactgattgcgaaaatttttgagaacgcgggaatccca
gaggggctgctgaatgtcgttgtcacagacattgcagaaatcggagacagctttgtggaa
cacccggtaccgcggatcatctcatttacaggttctacgaaagtcggcagctatatcggc
cagcttgcgatgaagcattttaaaaagccgcttcttgagctcggcggaaacagcgccttt
atcgtgcttgaagatgcggatatcgaatatgcggtcaatgcggcggtgtttagcagattt
acccatcaagggcagatctgtatgtcagccaaccgcgtacttgttcactcatcaatttat
gataagttccttgaaatgtatcaggcaaaagtggaatcgctgaaggttggcgacccgatg
gaccctgacacgattatcgggccattaatcaacagcagacagacggacgggctgatgaaa
tctgttgagaaagcgattgaagaaggggctgttccagtgaagcttggcgggtttaacggg
acaattgtggaaccgacgatcttaaaagacgtgaaaccgttcatgagcattgccaaggaa
gagctattcggacctgtcgtctcctttatgaagtttgattcagaagacgaagcggttgat
atcgcaaacgaaacgccgtttggtttgagcggtgccgtacatacgtcaaatcttgaacgc
ggcgtggcttttgcgaagcgcattgaaacaggcatgattcatgtcaatgacacgacaatc
aatgatgaaccgaatgtggccttcggcggtgaaaagcaatccggtctcggccgattgaac
ggcgagtggagccttgaagaatttacgacactgaaatggatttcggtccagcaccaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system