KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_04900
Entry
BSUW23_04900      CDS       T01302                                 

Symbol
yheJ
Name
(GenBank) hypothetical protein
Organism
bss  Bacillus subtilis subsp. spizizenii W23
SSDB
Other DBs
NCBI-ProteinID: ADM37034
UniProt: E0TXT2
LinkDB
Position
1006168..1006476
AA seq 102 aa
MKSEWKEGLLCQGICVFTKQFHIGAANPMFCLIERFFKSSRALKSAVHIISVKKGMELTL
HAFFIYKIEGKTGVWDVKTNTKARAAHVKRSEKSSKGKIEGG
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaaatcagaatggaaggagggtttgctatgccaaggaatttgcgtgtttacaaaacag
tttcatattggcgcggcaaaccctatgttctgtttgattgaacggttttttaagtctagc
cgcgcgctgaaaagcgctgtgcatatcatatcggttaaaaaaggcatggagctgacgctt
catgccttttttatatacaaaattgaaggaaagacaggtgtatgggatgtgaagacaaat
acaaaggcgagggcagctcatgtcaagcgaagcgaaaaaagcagcaagggaaaaatagaa
ggcggctga

DBGET integrated database retrieval system