KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_08115Help
Entry
BSUW23_08115      CDS       T01302                                 

Gene name
prkC
Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
KEGG Orthology (KO) [BR:bss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bss01001]
    BSUW23_08115 (prkC)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSUW23_08115 (prkC)
Protein kinases [BR:bss01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSUW23_08115 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo RIO1 Haspin_kinase Seadorna_VP7 CwsA Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADM37671
UniProt: E0TTP5
LinkDB All DBs
Position
1606391..1608337
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYVNDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTARIPFDGESAVSIALKHLQAETPSARRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIQTAFDADRLNEKRFTVQEDEEMTKAIPIIKDEE
LAKAAGEKEAELTSAQDNKTKKNGKRKKWPWVLLTICIVFITAGILAVTVFPSLFMPEDV
KIPDVSGMEYKKAAELLEKDGLQVDSEVLEISDEKIEEGLMVKTDPKADSTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKTLKDQGFKHVTVNEVNDEKSVGTVIEQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLIEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVEIPYEPENEGDEFEVQIAIDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcggacgttaccaaattctccgcgtcataggcggcggg
ggaatggccaacgtgtatttagctgaggatatcattctagaccgtgaagtcgctatcaaa
atcctgcggtttgactatgtgaacgacaatgagtttatcaggcgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtaagcatttacgatttgggcgaggaa
gatgatatctattatattgtcatggaatacgttgagggcatgacgcttaaagaatacata
acagcaaacgggccgcttcaccctaaagaagcgctgaacatcatggagcaaattgtctca
gccatcgcccatgcccatcaaaatcagattgttcacagagacattaagccgcacaacatt
ttgattgaccacatgggaaatatcaaagtgacggatttcggtattgcgacagcactaagt
tcgaccacaatcacccataccaattctgtgctgggctcagtccattatttatcacctgaa
caggcgcggggcggtttggcaacaaaaaaatcggatatttatgcgcttggaatcgttcta
ttcgagctcttaaccgcccgtatcccgtttgatggagaatcggcagtcagcatcgcctta
aagcatctacaggcagaaaccccttcggcgagaaggtggaatccgtcagtgccccaaagc
gttgaaaacatcatactaaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagatatccaaacagcttttgatgccgacagactcaatgaaaagaga
tttacggttcaagaagatgaagaaatgacaaaagcgatccctatcattaaagatgaagag
ctcgctaaagctgctggcgaaaaagaagctgaattgacatccgcccaagacaataaaaca
aagaaaaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcatcgttttc
atcacagctggaatcctcgctgtcaccgtttttccgtcgctttttatgcctgaagatgtc
aaaatacctgatgtctccggaatggagtacaaaaaggcggcagaactcttggaaaaagac
ggtttgcaagttgattcagaggttttagaaatctcagatgagaaaattgaagaaggcctg
atggtaaaaacggatcctaaagcggattccacagttaaagaaggcgcaacggtcacactt
tataagagcaccggaaaagctaaaacagagatcggtgatgtgacaggccaaacggtcgat
caggcaaaaaagaccttaaaggaccaagggtttaaacatgtaacggtgaatgaagtgaac
gacgagaaaagcgttggcactgtcattgaacagaatccgtcagcagggactgagcttgtg
ccgagtgaagatcaagtcaaactcacagtcagtatcgggcccgaagacattacgcttaga
gacttgaaaacgtacagtaaagaagcagcgtctggatatctggaagacaacggactgaag
ctgatagaaaaagaagcatactcagatgacgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggaacggcagtaaagccgggaaacgaagttgaagtgacattctctctggga
cctgagaaaaaacctgcgaaaacagtgaaagaaaaggtcgagatcccctatgagccagaa
aatgaaggggacgagtttgaagtgcaaatcgcgattgacgatgcggatcacagcatctct
gacacttatgaagaatttaagataaaagagccgactgaacggacgatcgaactaaagatt
gaacccggccaaaaagggtattatcaagtgatggtaaacaataaagtcgtcagctacaaa
accattgaatatccgaaagatgaataa

DBGET integrated database retrieval system