KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_10350Help
Entry
BSUW23_10350      CDS       T01302                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00020  Citrate cycle (TCA cycle)
bss00310  Lysine degradation
bss00380  Tryptophan metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
Module
bss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bss_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUW23_10350 (odhA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BSUW23_10350 (odhA)
   00380 Tryptophan metabolism
    BSUW23_10350 (odhA)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BSUW23_10350 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N Amidinotransf
Motif
Other DBs
NCBI-ProteinID: ADM38110
UniProt: E0TZ03
LinkDB All DBs
Position
complement(2096351..2099185)
Genome map
AA seq 944 aa AA seqDB search
MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSDIKEASG
TKEKGRVTADLIQKIASAVRLAEDIRTYGHLNASVNPLRKDGKKSELFPLSDYGLTEEEI
KAIPASVICKDAPKNITNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTKMIESGELF
QKNSAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTT
SVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLG
ANRELQDAETRSARITLANNPSHLEFINPIVEGSTRAAQETRTQSGYPVQDETKSLAILI
HGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTNYASDLAKGY
EIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLYD
AVRKHPTVKQIFAEKLVNEGVLTEEVVQNIEKSVTKRIEDAYQKVPAKKEHTASEIELPE
PVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFDDDRKVEWSLA
ESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGEEFVPLHHLSDCDTSFAVHN
SPLSEGSVLGFEYGYNVHSPETLVMWEAQYGDFANAAQVYFDQFISAGRAKWGQKSGLVM
LLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKMLLREEIRPL
VIMTPKSLLRNPNTVSEVQELSESRFQPVYEQSGLSHDYEKVTRLVLSSGKVSIDISDHF
NKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWSYISPYLT
EIAPQGVSVQYIGRRRRSSPAEGDPTVHKKEQERIVSDSLTRKN
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaatagtatgaaacaacgaatgaattgggaagatttttacggtccgaacctc
ggctatgcgctggagctttacgatcagtatacccaggatccgaacagcattgatccggat
ctaaaggaaatgttcgacgagctcggtgctccgccaagcgatataaaagaggcctcggga
acaaaagaaaagggacgtgttacagccgatctgattcaaaagatcgcatccgcagtcaga
cttgcagaagatatccgaacctatggccatttaaacgcttccgtcaatccgctcagaaag
gatggtaaaaagagcgaactctttccattatccgattacgggctaacagaagaagaaata
aaagcaatacctgcgtcagtgatttgcaaagacgctcctaaaaacattacgaacggttta
gaagccattcagtatttacgaaatacgtataaaagaaccatctcatttgaatttgaccat
gtgcatgacttcaaagagcgtgagtggctgacaaagatgattgaatccggcgagctgttc
cagaagaactcagctgaaaagctgtcggctgtgctggaaagactgacagaagtagagggc
ttcgagcagtttttacaccgcacattcgtcggacagaagcgcttttccattgagggatta
gacgctctagttccagtgctggatgacattattgcacaatctgtcaaatctggcacgacg
agtgtcaacatcgggatggcgcacagggggcgcctgaatgtcttggcacacgtgctcggc
aaaccgtatgaaatcattttctcagaattccagcatgcgccgaacaaagatcttgtcccg
tctgagggatcaatcggaatcagctatggatggacaggggatgtcaaatatcatctgggg
gccaatcgggagcttcaagacgctgaaacaagatcagcgcgcattacgttagcaaacaac
ccgagccacttggaatttatcaatccgattgttgaaggcagcacgagagcggcacaggaa
acgagaacacaaagcggatacccggtgcaagatgaaacaaaatcgcttgccattttaatt
catggagacgctgcattccctggggaaggaatcgtcgctgaaacattgaatttaagttct
ttaaaagggtatcaagtaggcggtgcgattcatattatcgccaataatatgatcggattc
acaacagaaagcgctgaatcaagatcgacaaactatgccagtgacctggcgaagggctat
gaaattccgattgttcacgtaaatgcggacgatccagaagcctgtctttcagctgttaag
tttgcggtcgaataccgaaaaacattcaacaaggactttctgattgacttgatcgggtac
agacgctacggacacaacgaaatggatgagccgtctaccactcagccgatgctgtatgat
gctgtcagaaagcatccgaccgtcaaacaaattttcgccgaaaagctcgtaaatgaaggc
gtgcttaccgaagaagttgttcaaaacatcgaaaaatcggtaacgaagcgcattgaggat
gcttatcagaaagtgccggctaaaaaggaacataccgcctctgaaattgaacttccagag
cctgtttcaaacggtttccctgatgtggacacatccattgattttgatgtgctccgtaag
ctgaatggcgaattaatcaattggccggagtcatttaacgttttcggcaagcttaagcgc
attttagaaagacgcgccaaggcgttcgatgatgatagaaaagtggaatggtctttggct
gaatcacttgcgtttgcttctattttgaaagacggaacaccgattcgtttaactgggcag
gattccgagcgcggaacgttcgcccaaagaaaccttgtgcttcatgacagtgagacgggc
gaagaatttgtgccgctgcatcacttatctgactgtgacacatcttttgctgttcataac
agcccgctgtctgaaggatcggttctcggctttgaatacggctataacgtgcattcaccg
gaaacgcttgtcatgtgggaagcgcagtatggagattttgccaacgctgctcaagtgtat
tttgaccaattcatttctgcaggacgcgcgaaatggggccaaaaatccggattagtcatg
cttcttccgcacggttacgagggacaggggcccgagcactcaagcggaagaatcgagcgg
ttcctgcagcttgccgcggaaaacaactggacggttgccaacctgacaagcgctgcacaa
tattttcatattttaagaagacaggccaaaatgctgcttcgtgaagaaatcaggccgctc
gtcattatgacgccgaagagccttcttcgtaatccgaatacggtttcggaagtgcaggag
ctcagcgaaagccgcttccagcctgtatacgaacagtccggactttctcatgactatgaa
aaagtaaccagacttgtattatccagcggtaaagtgtctatagacatcagcgaccatttc
aataagctagaagacggtaaagagtggcttcacattgcgagaattgaacagctgtatcca
ttcccggcaaaaggagtcaaagaattatttgcaaaacttccgaacctgaaagaaatcgtt
tgggtgcaggaagagccgcagaacatgggggcctggagttatatcagcccatatttgaca
gagattgcaccacagggagtaagcgttcaatatattggacgaagaagacgatccagccct
gcagagggagatccgacagttcataaaaaagaacaggaacgtattgtatctgatagcttg
actcgcaaaaactaa

DBGET integrated database retrieval system