KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_12405Help
Entry
BSUW23_12405      CDS       T01302                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSUW23_12405 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N MPTase-PolyVal
Motif
Other DBs
NCBI-ProteinID: ADM38519
UniProt: E0U451
LinkDB All DBs
Structure
PDB: 

Position
complement(2442461..2443069)
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD
LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALADDINSVFGSFDKFKEQFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacttccagaattaccttatgcgtacgatgctttagaaccgcatatcgac
aaggaaactatgactattcaccatacgaaacaccacaacacatacgttacaaatttaaac
aaagcggttgaaggaaacactgcacttgcaaacaaatcagttgaagagcttgttgcagat
cttgactctgttcctgaaaacatccgcactgcagtccgcaacaacggcggcggacacgcg
aaccacaaattattctggacacttttatctccaaacggcggaggagaaccgactggcgcg
cttgctgatgatatcaacagtgtatttggaagctttgacaaattcaaagagcaattcgca
gctgcagcagctggacgcttcggttctggctgggcatggcttgttgtgaacaacggcaaa
cttgaaatcacaagcacgccaaaccaagattctccgctttctgaaggcaaaacgcctatc
ttaggtcttgacgtttgggagcatgcttactaccttaactatcaaaaccgccgtcctgac
tacatttcagcgttctggaatgttgtaaactgggacgaagtggctcgtctatacagcgaa
gcaaaataa

DBGET integrated database retrieval system