KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13055
Entry
BSUW23_13055      CDS       T01302                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00051  Fructose and mannose metabolism
bss02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUW23_13055 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUW23_13055 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bss02000]
    BSUW23_13055 (levG)
Transporters [BR:bss02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUW23_13055 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: ADM38649
UniProt: E0TTX6
LinkDB
Position
complement(2552130..2552957)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLAVGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFIIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggaaaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttgctcggctcctttaacttcgaacgtgtgcaggccatggggtattgctatgtcatg
ataccggcgatcaaaaaattgtacggacctggagcgaaaagaaacgaagccttgcagcgg
catttggagtggtttaatacacacccgtggctgacagcgcctatattcggtgtgacggct
gccatggaagaagaaatggcgaacaataaaggaattgatggaaaagcaataagcggaatg
aaaatcggtttgatgggcccgatagcgggtgtaggcgatccgattttctggggaacgatt
cgcccggtcttagctgcgttaggggcatctcttgctgtaggaggaaacattgccggccct
ttgctattctttttcttgctgaacgccataagattaagcacaaaatattatgggttaaaa
tatggctatgtgaaaggaatggagattctgcaggatttagcggggaatcgcattcaaaag
cttacagagggtgcttcgattctcgggttatttgtaatgggagctctcgtttccaagtgg
accacgatcaacattccaatcgttgtgtccaggattaaggatgaaagcggaaaagtggat
gttcaaaccgtacaaaatgtgttagacagcattatgccgggtgcgctgcctctagggtta
acattattggtggcatggatgctgcgcaaaggtgtgaatcctcttctcattatttgcggg
atctttattatcgggattcttggatattgggctggattcttagcataa

DBGET integrated database retrieval system