KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13060
Entry
BSUW23_13060      CDS       T01302                                 

Gene name
levF
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00051  Fructose and mannose metabolism
bss02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUW23_13060 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUW23_13060 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bss02000]
    BSUW23_13060 (levF)
Transporters [BR:bss02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUW23_13060 (levF)
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: ADM38650
UniProt: E0TTX7
LinkDB
Position
complement(2552979..2553782)
AA seq 267 aa
MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADRYAKEGNIKGIEIMHITAMVFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KHNAHGAVAAASDGGHVAVYDDDDLDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcttcattacaaattattttgttgttaatcattgcagcaatcaccggcattgcaagt
gtgttggatgaggggcagacacaccggccgcttgtggcctgcacgttagtcggtttggtg
ctcggggatttaaaaacaggaattattctcggagggactctggagctgatggcgctgggc
tggatgaacgtcggccttgccatggcacctgatacagcgatcgcctctgtcatttcaacc
attttagtcattaccgccgatcagggaattggcgaagggattgcggttgctgttgcttta
gcagctgctggtcaggcgctgactatttttgtgcggacgatcactgtctttttcattcac
cgcgctgatcgatatgcaaaagaagggaatataaaaggaattgaaattatgcatataacc
gcgatggtgtttcaagcactgcgcgtgatgataccgacattgattgtcgcattgatcagt
gtcagcgctgttcaggcgttcttgggaaatattccggatgtgattacaaaagggctgcaa
ataggcggaggcattatcgtggttgtcggatatgccatggtgatcaatatgatgaatatt
ccttatttgaagccatttttctatattggatttttattagcagcgtttaccgatttcaac
ttagtgggatttggagcccttggtctctgtctggcacttttataccagcaggtgatgcaa
aaacataacgctcacggagcagttgctgccgcttcagatggcggccatgtggctgtttat
gatgacgatgaccttgatgcctaa

DBGET integrated database retrieval system