KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_13070
Entry
BSUW23_13070      CDS       T01302                                 

Gene name
levD
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIA component
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00051  Fructose and mannose metabolism
bss02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUW23_13070 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUW23_13070 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bss02000]
    BSUW23_13070 (levD)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSUW23_13070 (levD)
Transporters [BR:bss02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUW23_13070 (levD)
SSDB
Motif
Pfam: EIIA-man Phage_tail_APC
Other DBs
NCBI-ProteinID: ADM38652
UniProt: E0TTX9
LinkDB
Position
complement(2554287..2554727)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLLAVPFFKGEGIQTLQEKYRQALKDIPEENE
VLFLVDIFGGTPYNAAASLIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKTMS
RKSFQVCSEHLEKVKTANQETREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgcttgcagtgccgttttttaaaggggaaggc
attcaaacgctgcaagaaaaatatcgtcaggcgctcaaggacattccggaagaaaatgaa
gtgctttttttagtcgatatttttggaggaacgccatataacgcggcagcttctttaatt
gctgaggatcaaagaatggatatggcagccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggcacttaaagatttgctgaacaacttaaaaacaatgagc
cggaaaagttttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagaa
acaagagaggatgaattgtga

DBGET integrated database retrieval system