KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14160Help
Entry
BSUW23_14160      CDS       T01302                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00020  Citrate cycle (TCA cycle)
bss00480  Glutathione metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
bss01210  2-Oxocarboxylic acid metabolism
bss01230  Biosynthesis of amino acids
Module
bss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bss_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSUW23_14160 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSUW23_14160 (icd)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSUW23_14160 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADM38869
UniProt: E0TWL2
LinkDB All DBs
Structure
PDB: 

Position
complement(2775400..2776671)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNSASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGEKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggtgaaaaaattacagtttctaatggagtattaaacgtaccaaacaacccg
attatcccgtttatcgaaggagacggaaccggtcctgatatttggaactcggcttcgaaa
gttttggaagcagcagttgaaaaagcatacaaaggcgaaaagaaaattacgtggaaagaa
gtttatgccggagaaaaggcttataataaaacaggtgagtggctgcctgctgaaacatta
gatgttatccgcgaatatttcatcgcgattaaaggcccgttaacgacccctgtcggcggc
ggaatccgatctttgaacgtagcgctcagacaagagcttgacctattcgtctgcttaaga
cctgtaagatactttactggagtgccgtcaccggtaaaacgccctgaagatactgatatg
gtcatcttccgtgaaaatacagaagatatttacgcaggcatcgagtacgcaaaaggctct
gaagaagtgcaaaagctcatcagcttcctgcaaaatgagttaaacgtcaacaaaatccgt
ttccctgagacatcaggtatcggcattaagcctgtttctgaagaaggaacaagccgtttg
gtcagagcagccattgattatgcaatcgagcacggccgcaaatctgtaacccttgttcac
aaaggaaacatcatgaagttcacagaaggcgccttcaaaaactggggctatgaacttgct
gaaagagaatacggcgaaaaagtcttcacatgggctcaatatgaccgcattgctgaagaa
caaggaaaagacgctgccaacaaagcgcaaagtgaagcggaagcagcaggcaaaatcatt
gtcaaagacagcattgctgacatcttccttcagcagattttaacgcgaccgaacgaattt
gatgtcgttgcaactatgaacctgaacggagattacatctctgatgctcttgccgcgcaa
gtcggcggaatcggcattgcacctggagcaaatatcaactatgaaacaggacatgcgatt
ttcgaggcgacgcacggaacggctcctaaatatgcaggccttgataaagtaaacccatct
tcagttattctttcaggcgttctgcttcttgagcatttagggtggaacgaagcggctgat
ttggttatcaaatctatggaaaaaacaatcgcttctaaagtcgtaacttacgattttgcc
agattaatggacggcgcgactgaagtgaaatgttcagagttcggagaagaactgattaaa
aacatggactaa

DBGET integrated database retrieval system