KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_17085Help
Entry
BSUW23_17085      CDS       T01302                                 

Gene name
hisI
Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00340  Histidine metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01230  Biosynthesis of amino acids
Module
bss_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSUW23_17085 (hisI)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSUW23_17085 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BSUW23_17085 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADM39452
UniProt: E0U3L1
LinkDB All DBs
Position
complement(3367926..3368549)
Genome map
AA seq 207 aa AA seqDB search
MKQADELRFNEDGLIPAIVQDAVSKEVLTLAYMNKESYEKTLETKETWFYSRSRQELWHK
GETSGNTQAVTGIRYDCDQDALIVLVEPSGPACHTGSYSCFIKEQTEEQAAGRFDIINEL
ERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQALPLDDVLDVLKKRHSEK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagatgaactgcgttttaatgaggatggattaattcctgccatcgtgcag
gatgcggtaagcaaagaagtgctgacacttgcctatatgaacaaggaatcgtacgaaaaa
acgctggaaacgaaagaaacatggttttacagccgctcacgtcaagagttatggcataaa
ggagaaacctcggggaacacgcaagccgttacgggtattcggtatgactgcgaccaagac
gcgctgatcgtgctcgtagaaccgtccggaccggcatgccacactggcagctacagctgt
tttataaaggaacaaacagaagaacaggctgcgggccgatttgacatcattaacgagctg
gagcgcgtgatcgcggaacgccaagcggaaatgcctgaaggagcttacaccacttacctt
ttccgagaaggcgtcgataagattttgaaaaaagttggtgaagaagcatccgaagtcatc
atcgccgcgaaaaaccgagaccacgaggaactcaaatgggaagcggcagatctgctgtat
cacctgcttgtcctgctcagagaacaagcattgccgctggatgatgtgcttgacgtattg
aagaaacgacattctgaaaaataa

DBGET integrated database retrieval system