KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_18615
Entry
BSUW23_18615      CDS       T01302                                 

Gene name
bacF
Definition
(GenBank) aspartate aminotransferase involved in bacilysin synthesis
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00998  Biosynthesis of various secondary metabolites - part 2
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
Module
bss_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSUW23_18615 (bacF)
Enzymes [BR:bss01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSUW23_18615 (bacF)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ADM39757
UniProt: E0TW15
LinkDB
Position
complement(3674797..3675996)
AA seq 399 aa
MEITPSDVIKTLPKQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVSINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYAKAAAFAKEHNIHLIHDFAYGAFEFDKKPASFLGAEDAKVVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEQTESLKRIYEE
RIGFFTELCEKELGWKMEKPKGTFYVWAEIPKTFETSHQFSDYLLEHAHVVVTPGEIFGG
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFSSLQEVSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgacgtcatcaagacacttccaaagcaagagttttcactcgtt
tttcaaaaggtgaaggaattggaaaaaacgggggcccatatcattaatctcggacaggga
aaccctgaccttccgactccgccgcatattgtggaggctttgcgggaggcgtctctgaat
ccttcatttcacggatacggcccattcagaggctatccttttttgaaggaagcgatcgct
gctttctataaaagagaatacggggtgtcaatcaatcctgaaacggaagttgcgctcttt
ggcggcggaaaagccggcttgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttggtcccgaatccaggctaccctgaatacttgtcaggaattacgatggcgcgagct
gagctgcacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatc
gatcccgctgtgctggaaaaagcaaagctcatgtttttgaactatccgaataacccgacg
ggagctgtggccgatgcggctttttatgcaaaagcggctgcttttgcgaaagagcacaac
atccacttgattcatgatttcgcgtacggcgcgtttgaatttgataaaaagccggccagc
tttcttggggcagaggatgccaaagttgtcggggcagagctttattcgttttcaaaaaca
tttaacatggccggctggagaatggcgtttgccgtcgggaatgaaaagatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcggattgcagcaggcggcg
agtgccgctctttcaggagatccggagcaaacggaatccttgaaacgaatctacgaggaa
cgaattggcttttttacggagctgtgtgaaaaggaactgggctggaagatggaaaagcca
aaaggaacgttttacgtatgggctgaaattccgaaaacgtttgagacatctcaccaattc
tcagattacttgctggagcatgcccatgtcgttgtcacgccgggcgaaatattcggaggc
aacggaaaaaggcatgtcagaatatcgatggtgtcgaagcaggaggatttgcgggaattt
gtcatgcggattcaaaagctgaacctgccgttttcatcattacaagaagtatcccgctaa

DBGET integrated database retrieval system