KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0931Help
Entry
GYO_0931          CDS       T01635                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00970  Aminoacyl-tRNA biosynthesis
bst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bst00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GYO_0931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bst03029]
    GYO_0931
Enzymes [BR:bst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GYO_0931
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GYO_0931
Mitochondrial biogenesis [BR:bst03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GYO_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEP85615
UniProt: G4NUA8
LinkDB All DBs
Position
847784..849241
Genome map
AA seq 485 aa AA seqDB search
MSLFDHKITELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDE
AVDGRSEHGLLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIG
KLNMDEFAMGSSTENSAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIR
QPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDKMDSTS
ANVDVPDFLSSLTGDIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVSLP
HSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDPLT
MYANDILTIPVNLAGVPGISVPCGLADGLPLGLQIIGKHFDESTVYRVAHAFEQATDHHK
AKPEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcataaaatcacagaattaaaacagctcatacataaaaaagagatt
aagatttctgatctggttgacgaatcttataaacgcatccaagcggttgatgataaggta
caagcctttttggcattagatgaagaaagagcgcgcgcgtacgcgaaggagcttgacgag
gcggttgacggccgttctgagcacggtcttctttttggtatgccgatcggcgtaaaagat
aatatcgtaacaaaagggctgcgcacaacatgctccagcaaaattctcgaaaacttcgat
ccgatctacgatgctactgttgttcagcgccttcaagacgctgaagcggtcacaatcgga
aaattgaacatggacgaattcgccatggggtcatctaccgaaaactcagcttacaagctg
acgaaaaacccttggaacttagatacagttcccggcggttcaagcggcggttcagcggct
gcggttgctgcgggagaagttccgttttctcttggatctgacacaggcggttccatccgt
cagcctgcatctttctgcggcgtagtcggattaaagcctacatacggacgtgtatcccgt
tacgggctcgtcgcatttgcgtcttcattagaccaaatcgggccgattactcgtacggtt
gaggacaacgcattcttgcttcaagcgatttccggcgtagacaaaatggactccacgagt
gcaaatgtggacgtgcctgattttctttcttcattaactggcgatatcaaaggactgaaa
atcgccgttccgaaagaataccttggtgaaggtgtcggcaaagaagcgagagaatctgta
cttgccgcgttgaaagttcttgaaggcctcggcgctacatgggaagaagtgtctcttccg
cacagcaaatacgcgcttgcgacatattacctgctgtcatcttctgaagcgtcagccaac
cttgcacgctttgacggcatccgctacggctaccgtacagacaacgcggacaacctgatc
gacctttacaagcaaacgcgcgctgaaggtttcggaaatgaagtcaaacgccgcatcatg
ctcggaacgttcgctttaagctcaggctactacgatgcgtactacaaaaaagcgcaaaaa
gtgcgtaccttgattaagaaagacttcgaagacgtatttgagaaatatgatgttattgtc
ggaccgacgacaccgacaccagcatttaaaatcggtgaaaatacgaaagatccgcttaca
atgtacgcaaacgatatcttaacgattccggtcaaccttgccggcgtaccgggaatcagt
gtgccatgcggattagcagacggacttccgctcggcctgcaaatcatcggaaaacacttt
gatgaaagcactgtataccgtgttgctcatgcttttgaacaagcgacagaccatcataaa
gcaaaacctgaactgtaa

DBGET integrated database retrieval system