KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1477Help
Entry
GYO_1477          CDS       T01635                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00061  Fatty acid biosynthesis
bst00780  Biotin metabolism
bst01100  Metabolic pathways
bst01130  Biosynthesis of antibiotics
bst01212  Fatty acid metabolism
Module
bst_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GYO_1477
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GYO_1477
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GYO_1477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bst01004]
    GYO_1477
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GYO_1477
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GYO_1477
Lipid biosynthesis proteins [BR:bst01004]
 Fatty acid synthase
  Component type
   GYO_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AEP86129
UniProt: G4NWH4
LinkDB All DBs
Structure
PDB: 

Position
1357919..1358695
Genome map
AA seq 258 aa AA seqDB search
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLERND
SIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTTRDGFLLAHN
ISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLG
KENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSR
GITGENLHVDSGFHITAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcacttgaaggccgcaacattgttgtgatgggggtagccaacaaacgcagt
atcgcgtggggaattgcgcgctctttacacgaagcgggtgcacgtttgattttcacatac
gcaggagaacgccttgagaaatctgttcacgagcttgccggaacgctagaacgcaatgat
tccattatccttccttgcgacgtaacaaacgacgcggaaatcgaaacttgcttcgcaagc
attaaggagcaggtcggtgtgatccacggtatcgcgcattgtatcgcgtttgccaataaa
gaagagctcgtcggcgaatacttaaacacaactcgtgacggtttccttttggcccataac
atcagttcatattctctgacagctgttgtgaaagctgcacgtccgatgatgactgaaggc
ggaagcattgtcactttgacttaccttggcggagagcttgtgatgccgaactacaacgtc
atgggtgtagcgaaagcttctcttgatgcaagtgtgaaatacttagctgctgacttagga
aaagaaaatatccgcgttaacagcatttctgccggcccgatcagaacattatctgctaaa
ggcatcagcgatttcaactccatcttaaaagacattgaagagcgtgcgccgcttcgccgc
acgacaacacctgaagaagtgggcgatacagctgcgttcttattcagcgatatgtcccga
ggcattacaggtgaaaatcttcacgttgattcaggtttccatatcactgcccgctaa

DBGET integrated database retrieval system