KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1685Help
Entry
GYO_1685          CDS       T01635                                 

Definition
(GenBank) putative aspartate aminotransferase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00270  Cysteine and methionine metabolism
bst01100  Metabolic pathways
Module
bst_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYO_1685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bst01007]
    GYO_1685
Enzymes [BR:bst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     GYO_1685
Amino acid related enzymes [BR:bst01007]
 Aminotransferase (transaminase)
  Class I
   GYO_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEP86329
UniProt: G4NVH1
LinkDB All DBs
Position
1534383..1535576
Genome map
AA seq 397 aa AA seqDB search
MKFEQSHVLKELPKQFFASLVQKVNRKLAEGHDVINLGQGNPDQPTPEHIVEEMKRAVAD
PENHKYSSFRGSYSLKSAAAAFYKREYGIDLDAETEVAVLFGGKAGLVELPQCLLNPDDT
ILVPDPGYPDYWSGVTLAKANMEMMPLVKDRAFLPDYSSIAAEVREQAKLMYLNYPNNPT
GAVATSEFFEETVSFAKENGICVVHDFAYGAVGFDGCKPLSFLQTEGAKDIGIEIYTLSK
TYNMAGWRVGFAVGNASVIEAINLYQDHMFVSLFRATQEAAAAALLADQTCVAEQNARYE
SRRNAWIAACREIGWDVTAPAGSFFAWLPVPEGYTSEQFSDLLLEKANVAVAAGNGFGEY
GEGYVRVGLLTSEERLKEAAYRIGKLNLFTQKSIDKI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaacagtctcatgtattgaaagaattgcctaaacaattcttcgcttctctg
gtgcagaaagtgaaccgaaagctcgcagaaggacacgacgtcatcaatctcggacaggga
aatccggatcagccgactccggaacatatcgtcgaggaaatgaaacgagccgttgcggat
cctgaaaatcataaatactcgtcttttcgcggctcatacagtctgaaatcagccgcagca
gcattttataaacgagaatacggtatcgatcttgacgcggaaactgaagtcgctgtatta
ttcggcgggaaagccggtctggtcgagctcccgcaatgcttgttgaatccggatgatacg
attttagttccggatccgggctatcctgattactggtcaggtgtcacactcgcgaaagcg
aatatggaaatgatgccgctcgtaaaggacagggcgtttcttcctgattacagcagcatc
gcggctgaagtaagggaacaggcgaaattgatgtatttgaattatccgaataatccgacg
ggagctgttgctacctccgagttttttgaagaaaccgtgagttttgcgaaagaaaacggg
atctgtgtcgttcatgattttgcttacggcgctgtaggatttgacggctgcaagccgtta
agctttttgcagactgaaggtgcgaaggatatcggaattgaaatttatacgctgtcaaaa
acgtataacatggcagggtggcgggtcggttttgctgtcggaaacgcttcggtcattgaa
gcgatcaatctttatcaagaccatatgtttgtcagtcttttcagagcgactcaggaggct
gcagcggcggcactgctagctgatcagacgtgtgtggcggagcaaaatgcccgatatgag
agcaggcgaaacgcttggattgcggcatgccgggaaatcggctgggatgtgacagctccg
gcaggttcattttttgcatggctgcctgtgcctgaaggctatacttccgagcagttctca
gaccttttgctggaaaaagcgaatgtggcggttgcggctggaaacggcttcggtgaatat
ggcgagggctacgtcagagtcggactgctgacaagtgaagaaagactcaaagaagccgct
tatcgaattgggaaactgaacctgtttacccaaaaaagcattgacaagatctga

DBGET integrated database retrieval system