KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2938
Entry
GYO_2938          CDS       T01635                                 

Definition
(GenBank) fructose permease IID component
  KO
K02771  fructose PTS system EIID component
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00051  Fructose and mannose metabolism
bst02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYO_2938
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    GYO_2938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bst02000]
    GYO_2938
Transporters [BR:bst02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    GYO_2938
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AEP87544
UniProt: G4NXV4
LinkDB
Position
complement(2708633..2709460)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFIIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaaagattaacgaaaaaagaaattttcagcatgtttattcgttcgaat
tttttgctcggctcctttaacttcgaacgtgtgcaggccatgggatattgctatgtcatg
attccggcgatcaaaaaactgtacggacccggagcgaaaagaaacgaagccttgcagcgg
catttggaatggtttaatacacatccgtggctgactgcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgatggaaaagcaataagcggaatg
aaaatcggtttgatgggcccgatagcgggtgtaggcgatccgattttctggggaacgatt
cgtccggtcttagctgcgttaggggcatcccttgctttaggaggaaacattgccggccct
ttgctattctttttcttgctgaacgccataagattaagcacaaaatattacgggttaaag
tatggctatgtgaaaggaatggagattctgcaggatttagcggggaatcgcattcaaaag
cttacagagggtgcttcgattctcgggttatttgtaatgggggctctcgtttccaaatgg
accacgatcaacattccaatcgttgtgtccaggattaaggatgaaagtggaaaagtggat
gttcaaaccgtacaaaatgtgttagacagcattatgccgggtgcgctgcctctggggtta
acgttattggtggcatggatgctgcgcaaaggggtgaatcctcttcttattatttgcggg
atctttattatcgggattcttggatattgggctggattcttagcataa

DBGET integrated database retrieval system