KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2941
Entry
GYO_2941          CDS       T01635                                 

Definition
(GenBank) fructose-specific phosphotransferase enzyme IIA component
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00051  Fructose and mannose metabolism
bst02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYO_2941
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    GYO_2941
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bst02000]
    GYO_2941
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     GYO_2941
Transporters [BR:bst02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    GYO_2941
SSDB
Motif
Pfam: EIIA-man Phage_tail_APC
Other DBs
NCBI-ProteinID: AEP87547
UniProt: G4NXV7
LinkDB
Position
complement(2710796..2711236)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLLAVPFFKGEGIQTLQEKYRQALKDIPEENE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLTLKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQETREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagtggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgcttgcagtgccgttttttaaaggggaaggc
attcaaacgctgcaagaaaaatatcgtcaggcgctcaaggacattccggaagaaaatgaa
gtgctttttttagtcgatatttttggaggaacgccatataacgcggcagcttctttcatt
gctgaggatcaaagaatggatatggcagccggtgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctgacacttaaagatttgctgaacaacttaaaagcaatgagc
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaactgccaatcaggaa
acaagagaggatgaattgtaa

DBGET integrated database retrieval system