KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_2998Help
Entry
GYO_2998          CDS       T01635                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase YrvJ
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bst00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    GYO_2998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bst01011]
    GYO_2998
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bst03036]
    GYO_2998
Enzymes [BR:bst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     GYO_2998
Peptidoglycan biosynthesis and degradation proteins [BR:bst01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   GYO_2998
Chromosome and associated proteins [BR:bst03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    GYO_2998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SH3_3 Amidase_3 SH3_4 SH3_16 AKAP2_C
Motif
Other DBs
NCBI-ProteinID: AEP87602
UniProt: G4NY93
LinkDB All DBs
Position
2764114..2765796
Genome map
AA seq 560 aa AA seqDB search
MHTFLIVFMPSINKSFYFYLKIRKDFTIISKNAFLMIIRKEDTMSKKYFVLIVSIIFAGA
LFPPLSSVTAAQGEAVIATDEMNVRSGPGLSYGITAEAKKGERYPILKEDGDWVQIQLGS
GEKGWVVSWLITKEDQASTSSTESSDTVTSTDPDLRMRTGPGTSYEVIGKFPQGSQASVI
DKDSGWIKISYQNATGWVSSEYVTSGRSSSASSESAQTESSGASTGTVGVSSLNVRASAS
HDAAILTKLERGTKLTILNEKNGWAHIEVNGLKGWVASHYLLSSSDPAESSANAGSSSSA
KKAYIVYGGTNVRSDASTSASIVERAAKGDSFTITGSKGSWYEIKLDNGQTGYVANWVVQ
TSKSAEEAGEPPVSDSPSGNGSLNNKTIIVDPGHGGKDSGTIGYSGKFEKNLTIKTAKLL
ASKLRSAGADVYVTRQDDTFVSLQSRVSTSHYRNADAFISIHYDSYADTSTRGSTAYYYS
PAKDEELASDVHSEVVKRSSIPDRGVLFGDYYVLRENRQPAMLYELGYVSHPQEEAIVHS
NSYQEKVTDGIESGLEKYFQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
ttgcacacctttttgattgtatttatgcctagtataaacaaatcattttatttttattta
aaaatcagaaaggactttacgataataagcaagaatgcttttttaatgatcatcagaaag
gaggacacaatgagcaagaaatactttgttcttattgtatctattattttcgccggggcg
cttttcccgccactttcctccgttacagccgctcaaggagaagcggtcatcgcaacagat
gaaatgaacgtcagaagcggtccggggcttagctacgggattacagcggaagcgaaaaaa
ggagagcgctacccgattttaaaggaagatggagactgggtgcagatacagcttggttcc
ggagaaaaaggatgggtggtctcctggctgattacaaaggaagaccaggccagcacaagc
tctacggaaagcagtgatactgtgacttcaacagaccccgatctgcggatgagaaccgga
ccgggcacttcatacgaagtcatcggcaaattcccgcaaggcagccaagcgtctgtcatc
gataaagattcaggctggatcaagatatcctatcaaaatgccactgggtgggtgtcatct
gaatatgttacatcaggccgcagcagttcagcgtcttctgagagtgctcaaaccgaatct
tccggtgcttcaacgggcacggtcggtgtatcttcactaaatgtaagagcctccgcctca
catgacgcagcgattttaacgaaacttgaacgcggaacgaagcttacgattctcaacgag
aaaaacggctgggcccacatcgaggtgaatgggctgaaaggctgggttgcaagccattac
cttttatctagttctgatccagctgaaagttcggcaaatgccggcagttcatcctccgct
aaaaaagcctatattgtatacggaggaacgaatgtaagaagtgatgcatctacatcagct
tcgatcgttgaacgtgctgccaaaggcgattcgttcaccattacaggttcaaagggcagc
tggtatgagattaagcttgataacgggcagactggttatgtagccaattgggtggtccaa
acgtctaaaagcgcagaagaagcaggtgaaccccctgtctctgattccccgtccggaaac
ggttctctgaacaataaaacgattattgttgacccgggacacggaggaaaagacagcgga
acgatcggctattcgggtaaattcgagaaaaacctgacgatcaaaacggcaaaactgctt
gccagtaaactcagatcagctggagccgatgtgtatgtgacacgccaggatgataccttt
gtcagcttacagtcacgtgtttctacgtctcactatcgcaacgctgacgcatttatcagc
attcactatgacagctatgcggatacttccacgagaggcagcactgcttactactacagt
cctgccaaagatgaggaactggcatcagatgtacactctgaagtggtgaagcgttcttcc
attcctgaccgcggcgtattattcggagattattatgtgcttcgggaaaatagacagccc
gctatgctgtatgagctgggatatgtaagccatccgcaggaagaagccattgtacatagc
aattcataccaagaaaaagttacagacgggattgaaagcggactagagaaatacttccaa
taa

DBGET integrated database retrieval system