KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3172Help
Entry
GYO_3172          CDS       T01635                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00010  Glycolysis / Gluconeogenesis
bst00030  Pentose phosphate pathway
bst00051  Fructose and mannose metabolism
bst00052  Galactose metabolism
bst00680  Methane metabolism
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
bst01130  Biosynthesis of antibiotics
bst01200  Carbon metabolism
bst01230  Biosynthesis of amino acids
bst03018  RNA degradation
Module
bst_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bst_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYO_3172 (pfkA)
   00030 Pentose phosphate pathway
    GYO_3172 (pfkA)
   00051 Fructose and mannose metabolism
    GYO_3172 (pfkA)
   00052 Galactose metabolism
    GYO_3172 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    GYO_3172 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GYO_3172 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bst01009]
    GYO_3172 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bst03019]
    GYO_3172 (pfkA)
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GYO_3172 (pfkA)
Protein phosphatases and associated proteins [BR:bst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GYO_3172 (pfkA)
Messenger RNA biogenesis [BR:bst03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GYO_3172 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEP87774
UniProt: G4NZ77
LinkDB All DBs
Structure
PDB: 

Position
complement(2934723..2935682)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
DTKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatttatcatgacgttgaagtgtacggcatttacaacgga
tacgcaggattgatcagcggaaagattgaaaagcttgagctcggatctgtaggcgatatt
atacatcgcggaggaacaaagctttatacggcaagatgtcctgaattcaaaacggttgaa
ggccgtgaaaaagggatagaaaacttgaaaaagcttggtattgaaggtcttgttgtcatc
ggcggagacggttcctatatgggtgcgaaaaaattaacagaacatgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtgatcgaagtaatgggccgccatgccggtgatatcgcattgtgggcc
ggtcttgcagggggcgcggaatcaatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaaacacagtattattatcgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtactgggccatatccagcgcggaggttctccaagcgctgctgac
cgcgtgctggcaagccgtcttggcgcatatgctgttgaactgctgctagaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactg
gatacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system