KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4155
Entry
GYO_4155          CDS       T01635                                 

Definition
(GenBank) transaminase MtnE
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00998  Biosynthesis of various secondary metabolites - part 2
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
Module
bst_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    GYO_4155
Enzymes [BR:bst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     GYO_4155
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AEP88724
UniProt: G4NXM0
LinkDB
Position
complement(3856192..3857391)
AA seq 399 aa
MEITPSDVIKTLPKQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVSINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADVAFYAKAAAFAKEHNIHLIHDFAYGAFEFDKKPASFLEAEDAIAVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEQTESLKRIYEE
RIDFFTELCEKELGWKMEKPKGTFYVWAEIPTTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFASLQEASR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgacgtcatcaagacacttccaaagcaagagttttctctcgtt
tttcaaaaggtgaaggaattggaaaaaacgggggcccatatcattaatctcggacaggga
aaccctgatcttccgactccgccgcatattgtggaggctttgcgggaggcgtctctgaat
ccttcatttcatggatacggcccattcagaggctatccttttttgaaggaagcgatcgct
gctttctataaaagagaatacggggtgtcaatcaatcctgaaacggaagttgcgctcttc
ggcggcggaaaagccggcttatatgtgctgacacaatgcctgcttaatccgggagacatc
gctttggtcccgaatccaggctaccctgaatacctgtcaggaattacgatggcgcgagct
gagctgcacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatc
gatcccgctgtgctggaaaaagcaaagctcatgtttttgaactatccgaataacccgacg
ggagctgtggccgatgtagctttttatgcaaaagcggctgcttttgcgaaagagcacaac
atccacttgattcatgattttgcgtacggcgcgtttgaattcgataaaaagccggccagc
tttcttgaggcagaggatgccatagctgtcggagcagagctttattcattttcaaagaca
tttaacatggccggctggagaatggcgtttgccgtcgggaatgagaagatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcggattgcagcaggcggca
agtgccgcgctttcaggagatccggagcaaacggaatccttaaaacgaatctacgaggaa
cgaattgacttttttacggagctgtgtgaaaaggaactgggctggaagatggaaaagcca
aaaggaacgttttacgtatgggctgaaattccgacaacgtttgagacatctcaccaattc
tccgattacttgctggagcatgcccatgtcgttgtcacaccgggcgaaatattcggaagc
aacggaaaaaggcatgtcagaatatcgatggtgtcgaagcaggaggatttgcgggagttt
gtcatgcggattcaaaagctgaacctgccgtttgcatcattacaagaagcatcccgctaa

DBGET integrated database retrieval system