KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4414Help
Entry
GYO_4414          CDS       T01635                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GYO_4414 (ahpF)
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GYO_4414 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like Thi4 DAO FAD_oxidored NAD_binding_7 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEP88971
UniProt: G4NZ08
LinkDB All DBs
Position
4107279..4108808
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKSEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKLGSGADASEFADKDPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLDGTVERNDIGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaat
gatattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcaaaaatttcagttgaaaaaactgaattaaacaga
acgccaagcttcagtgtcaatcgtgtcggagaagacactggcgttacattcgccggtatc
cctctgggccacgaattcacatcattagtcttggcattgctccaagtgagcggcagaccg
cctaaggtagaccaaaaagtcattgatcaggtgaaaaagatcagcggtgaataccacttt
gaatcttatatcagcctgacatgccacaactgtcctgacgttgtacaagctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgatcgacggtgcagcatacaaatca
gaagttgaaagcaaaaatatcatggcagtgccgaccgtttacctgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaattcttgcgaaattgggcagcggcgcagatgca
tctgagtttgctgacaaagacccgtttgacgttcttgttgtcggaggcggacctgctggc
gcaagtgcagccatctacactgcgcgtaaaggcatccgcactggtgttgtcgctgagcgc
ttcggcggacaggttctcgacacaatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggtccgaagcttgctgcaagtcttgaagagcacgtgaaggaatatgatattgacgtc
atgaaccttcagcgcgcaaaacgccttgagaagaaagatctgttcgaacttgaacttgaa
aacggcgctgtcctgaaaagtaaaacagtgatcctgtcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgtagcggttatcggcggcggaaactctggaatc
gaagcagcgattgaccttgcaggtattgtcaatcacgttactgtgctagagttcgcgcca
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagtctgccaaacgtcactgtc
gtgaaaaatgcacaaacaaaagaaatcacaggcgatcagagcgttaacggcatcacatac
gtagaccgcgaaacaggcgaagaaaaacacgttgaactccaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagacggaacggttgaacggaacgacatcggcgaa
atcatcgtcgacaaacacggtgcaacaagcgttccaggcttatttgctgccggcgactgc
acagacagcgcgtacaaccaaatcattatttcgatgggatcaggtgcaactgccgctctc
ggcgcgtttgattaccttatccgtaactaa

DBGET integrated database retrieval system