KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_4492Help
Entry
GYO_4492          CDS       T01635                                 

Definition
(GenBank) YyaS
  KO
K07149  uncharacterized protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    GYO_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane
Motif
Other DBs
NCBI-ProteinID: AEP89044
UniProt: G4NZG2
LinkDB All DBs
Position
4180351..4180962
Genome map
AA seq 203 aa AA seqDB search
MITNKMKYVYYVLGILILSLGISLTIQSGLGTSPFDALLVGLSKEVGLTVGSWEVLISVI
LLICNSILTRKKPMLLGLVTAFITGIGIDLWLFVVKNTIYLNALLSKLICFGIGLVFIGL
GTAIYLQTKFASTPIDHLTLIIRDISKRTILFSRTLVYALFFVLAIICKGPIGIGTLLTV
CLGGIILHFFMPFVERRFLSSKM
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgaataaaatgaaatatgtttattacgtgttaggtatcctcatattaagttta
ggcatttctttaacgatacaatcaggattaggcacatcgcccttcgatgcccttttggtt
ggcctttcaaaagaagtcggtcttaccgtgggaagctgggaggtccttatttctgtgatc
ctcttaatctgtaactctatattaacgagaaaaaagcctatgttgctggggttggttaca
gcattcattactgggataggcattgacctatggttgtttgttgtaaaaaataccatttat
ctaaacgcgttgttaagcaaactgatttgtttcggaattggtttggtgttcatcggtctt
ggaacagccatctatcttcagacgaaatttgcatcaactcctatcgatcatttaacactc
atcatccgagatatctccaaaagaacgatcttattttcaagaacattggtatatgctctt
ttcttcgtattagctattatatgtaaaggccctatcggcatcggaacgcttttaactgtt
tgtttaggaggaataatccttcacttttttatgccttttgttgaaagacgcttcttatcc
tcaaaaatgtaa

DBGET integrated database retrieval system