KEGG   Burkholderia stagnalis: WT74_07155Help
Entry
WT74_07155        CDS       T04885                                 

Definition
(GenBank) oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00061  Fatty acid biosynthesis
bstg00780  Biotin metabolism
bstg01100  Metabolic pathways
bstg01130  Biosynthesis of antibiotics
bstg01212  Fatty acid metabolism
Module
bstg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WT74_07155
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WT74_07155
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    WT74_07155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bstg01004]
    WT74_07155
Enzymes [BR:bstg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     WT74_07155
Lipid biosynthesis proteins [BR:bstg01004]
 Fatty acid synthase
  Component type
   WT74_07155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AOK52506
LinkDB All DBs
Position
1:1608742..1609488
Genome map
AA seq 248 aa AA seqDB search
MSKLSGKVAIVTGGSKGIGAAIAKALAAEGASVVVNYASSKAGADAVVSAITAADGKAIA
VGGDVTKAADAQRIIDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHFRKQFDTNVLGLL
LTTQAAVKHLGEGASIINISSVVTSITPPASAVYSGTKGAVDAITGVLSLELGPRKIRVN
AINPGMVVTEGTHSAGIIGSDLETQVRAQTPLGRLGQPDDIASIAVFLASDDARWLTGER
IVASGGLH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctttcgggcaaggtagcgatcgtgacgggcggctccaagggcatcggcgcc
gcgattgccaaggcgctcgccgccgaaggggcgtcggtcgtcgtcaactatgcgagcagc
aaggccggcgccgatgcggtcgtgagcgcgatcacggcggccgacggcaaggcgatcgcc
gtcggcggcgacgtgacgaaggcggccgacgcgcagcgcatcatcgacacggcgatcgag
acctatggccgtctcgacgtcctcgtcaacaattccggcgtgtacgaattcgcgccgatc
gaagcgatcaccgaggaacatttccgcaagcagttcgacacgaacgtgctcgggctgctg
ctgacgacgcaggcggccgtgaagcacctcggcgaaggcgcgagcatcatcaacatcagc
tcggtggtgaccagcatcacgccgccggccagcgcggtgtacagcggcacgaagggcgcc
gtggacgccatcaccggcgtgctctcgctcgaactcggcccgcgcaagattcgcgtgaac
gcgatcaatccgggcatggtggtgaccgaaggcacgcacagcgcggggatcatcggctcc
gacctcgaaacgcaggtgcgcgcccagacgccgctgggccgcctcgggcaaccggacgac
atcgcctcgatcgcggtgtttctcgcgtcggacgatgcgcgctggctgaccggcgagcgc
atcgtggcgagcggcggcctgcactga

DBGET integrated database retrieval system