KEGG   Burkholderia stagnalis: WT74_12980Help
Entry
WT74_12980        CDS       T04885                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00620  Pyruvate metabolism
bstg00680  Methane metabolism
bstg00710  Carbon fixation in photosynthetic organisms
bstg01100  Metabolic pathways
bstg01120  Microbial metabolism in diverse environments
bstg01200  Carbon metabolism
Module
bstg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WT74_12980
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    WT74_12980
   00680 Methane metabolism
    WT74_12980
Enzymes [BR:bstg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WT74_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOK53531
LinkDB All DBs
Position
1:2912703..2915708
Genome map
AA seq 1001 aa AA seqDB search
MKSSGSARTARRNAALPSSDAQTGSVAAAANGRAKPATKPKDPIRQTKRAAEAAGAAVTA
AKPNGRTREDKDRPLFEDIRFLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDRDA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAFA
LDQLKQAGGASKGVLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQELTA
RERQHNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLPARVPAFFQMGSWIGGDRDGNPNVTATTLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRVGEGTVPVRS
AGRGTPPVRATPYADSEEFVRDLKVLMESLAEHHGASLAAPRLAPLARAAEVFGFHLASI
DLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRLPYFEYSALAQ
SELGVFEKARAVRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLEGALGAKHGGAR
NGLMVIPLFETIPDLRDASRIMREYFALPGVESLVAHQGGEQEVMLGYSDSNKDGGFLTS
NWELYRAELALVDLFRERGITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQ
GEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAHLPAFETAMQTLSDAAMASYRA
LVYETPGFTDYFFSSTPISEIAELNIGSRPASRKLQDPKHRRIEDLRAIPWGFSWGQCRL
LLTGWYGFGSAVAAYLDGAKDDAERAKRLALLKKMHKTWPFFSNLLSNMDMVLAKTDLAV
ASRYAQLVADKKLRKHVFERIVAEWERTSQALAEITGHGTRLATNPLLARSIKNRFPYLD
PLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggcgcgccgcaatgctgccttgccctcctccgat
gcccagacgggctccgtcgccgccgccgcgaacggccgtgcgaaaccggcaaccaaaccg
aaagacccgatacgtcagaccaaacgcgcggccgaggccgccggcgcagccgtcacggcg
gcgaagccgaacggccgcacgcgcgaggacaaggaccgcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtcgtgcgcgagcaggaaggcgacgcggtgttcgac
gtggtcgagacgatccgccagaccgcggtgaaattccgccgcgaggacgaccgcgacgcc
gcgcagacgctcgagaagaagctgcgcaagctgacgccggagcagacggtgagcgtcgtg
cgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggatcgccaccacaaccgg
cgccgccgcatccacgcgctcgccggctccgcgccgcagcccggcaccgtcgcgttcgcg
ctcgaccagctgaagcaggcgggcggcgcgtcgaagggcgtgctgcagcgcttcttcgac
gacgcgctgatcgtgcccgtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatc
ctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccaggagctgaccgcg
cgcgagcgccagcacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacg
cggatgctgcgcgacgcgcgcctgaccgtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgaggccgcgctg
gccgagcacggcctgcccgcccgcgtgccggcgttcttccagatgggcagctggatcggc
ggcgaccgcgacggcaacccgaacgtcaccgccacgacgctcgacgaggcgatcaaccgc
caggccgcggtgatcctcgagcactacctggaacaggtgcacaagctcggcgccgagctg
tcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaggccctcgccgccgcgtcg
ccggaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctgatcggcatctac
acgcggctcgccgcgagcgcgcgggtgcgcgtgggcgaaggcacggtgccggtgcgcagc
gccgggcgcggcacgccgccggtacgcgcgacgccgtatgccgattccgaggaattcgtg
cgcgatctcaaggtgctgatggaatcgctcgccgagcatcacggcgcatcgctcgccgcg
ccgcgcctcgcgccgctcgcgcgcgcggccgaggtgttcggtttccacctggcgagcatc
gacctgcggcagagctccgacatccacgaggcggtggtcgccgagctgttcgcgcgcgcc
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagctgcgcgtgctgctcgcc
gcgctcgccgatccgcggccgctgcgcttgccgtacttcgagtactcggcgctcgcgcag
agcgagctcggcgtgttcgagaaggcgcgcgcggtgcgtgcgcagttcgggccgcgcgcg
gtgcgcaactacatcatctcgcacaccgagacggtcagcgacctcgtcgaagtgctgctg
ctgcagaaggaaaccggcctgctcgaaggcgcgctcggcgcgaagcacggcggcgcgcgc
aacggcctgatggtgatcccgctgttcgaaacgattcccgacctgcgcgatgcgtcgcgg
atcatgcgcgagtacttcgcgctgccgggcgtcgaatcgctggtcgcgcaccagggcggc
gagcaggaagtgatgctcggctactcggacagcaacaaggacggcggcttcctcacgtcg
aactgggagctgtatcgcgccgaactcgcgctcgtcgacctgttccgcgagcgcggcatc
acgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggcccgacctac
caggcgatcctgtcgcagccgcccggcaccgtgaacggccagatccgcctgaccgaacag
ggcgaggtgatcgcgagcaagttcgcgaacccggaaatcggccgtcgcaacctcgaaacc
gtcgtcgccgcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgcccgcgcacctg
ccggcgttcgagacggcgatgcagacgctgtccgatgcggccatggcgtcgtaccgcgcg
ctcgtctacgagacgcccggcttcaccgactacttcttctcgtcgacgccgatcagcgag
atcgccgagctgaacatcggcagccggcccgcgtcgcgcaagctgcaggatccgaagcac
cgccggatcgaggatctgcgcgcgattccgtggggcttctcgtggggccagtgccgcctg
ctgctgaccggctggtacggcttcggcagcgcggtggccgcgtatctggacggcgcgaag
gacgacgccgagcgcgccaagcgcctcgcgctgctgaagaagatgcacaagacctggccg
ttcttctcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgacctcgcggtc
gcgtcgcgctacgcgcagctcgtcgcggacaagaagctgcgcaagcacgtgttcgagcgg
atcgtcgccgagtgggagcgcacgtcgcaggcgctggccgagatcaccggccacggcacg
cggctcgcgaccaacccgctgctcgcgcgctcgatcaagaaccgcttcccgtatctcgat
ccgctgaaccacctgcaggtcgagctgatcaagcggcaccgcgcgggcgacaccaacgcg
cggctgcggcgcgggattcacctcaccatcaacgggatcgccgccggcctgcgcaacacc
ggctga

DBGET integrated database retrieval system