KEGG   Burkholderia stagnalis: WT74_13125Help
Entry
WT74_13125        CDS       T04885                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00860  Porphyrin and chlorophyll metabolism
bstg01100  Metabolic pathways
Module
bstg_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WT74_13125
Enzymes [BR:bstg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     WT74_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AOK53559
LinkDB All DBs
Position
1:complement(2949722..2950306)
Genome map
AA seq 194 aa AA seqDB search
MDVVLIRHPAVGVEPGVCYGRSDVPLAASAEAGAQAMRARLAELCAPLPQCVWSSPLVRC
ASVGAPLAQALGVPLRRDACWQEMDFGAWEGQRWNDIDRAALDAWAADLMHASAHGGESV
ARFAARVSRAVDSAVETRAPQWAVTHAGVIRAFASQALHVPLDMLLSRPVPFGGVVWLRM
HDAAGGWELVHWDA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtcctgatccggcatccggcggtcggcgtcgagccgggcgtgtgctacggg
cgcagcgacgtgccgctcgccgcatcggccgaggccggcgcgcaggcgatgcgcgcgcgt
ctcgccgaactgtgcgcgccgctgccgcaatgcgtgtggtcgagcccgctcgtgcgctgc
gcatcggtcggcgcgccgctcgcgcaggcgctcggcgtgccgctgcggcgcgatgcgtgc
tggcaggaaatggatttcggcgcgtgggaagggcagcgctggaacgacatcgaccgcgcc
gcgctcgatgcctgggcggccgacctgatgcatgcgagcgcgcatggcggcgaaagcgtg
gcgcgcttcgccgcgcgggtttcgcgcgcggtcgattcagccgtggaaacccgcgcgccg
caatgggccgtcacgcatgcgggggtgattcgcgcgtttgcgtcgcaggcgctgcacgtg
ccgctcgacatgctgctgtcgcggccggtgccgttcggcggcgtcgtgtggctgcgcatg
cacgatgcggccggcggctgggagctcgtgcactgggacgcatga

DBGET integrated database retrieval system