KEGG   Burkholderia stagnalis: WT74_13200
Entry
WT74_13200        CDS       T04885                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg03030  DNA replication
bstg03430  Mismatch repair
bstg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    WT74_13200
   03430 Mismatch repair
    WT74_13200
   03440 Homologous recombination
    WT74_13200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bstg03032]
    WT74_13200
   03400 DNA repair and recombination proteins [BR:bstg03400]
    WT74_13200
Enzymes [BR:bstg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     WT74_13200
DNA replication proteins [BR:bstg03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     WT74_13200
DNA repair and recombination proteins [BR:bstg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     WT74_13200
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AOK53573
UniProt: A0A102WLA1
LinkDB
Position
1:complement(2963690..2964106)
AA seq 138 aa
MTRIDFHTNVGDSLAYACRLLRKAYQAGLPVVVLAEPARLRALDERLWTFSPLDFIPHCG
VDSAHAADTPIVLTTDLDKAPHHQVLLNLGATVPAQFARFERLLEVVGNEPAELAAGRER
YRFYRDRGYALNNHKQGS
NT seq 417 nt   +upstreamnt  +downstreamnt
atgacgcggatcgatttccacacgaacgtcggcgattcgctcgcctacgcgtgccggctg
ctgcgcaaggcctaccaggccgggctgccggtcgtcgtgctcgccgagcccgcgcgcctg
cgcgcgctcgacgagcggctctggacgttctcgccgctcgatttcatcccgcattgcggg
gtcgacagcgcgcacgcggccgatacgccgatcgtgctgaccaccgatctcgacaaggcg
ccgcatcatcaggtgctgctgaatctcggcgcgacggtgccggcgcagttcgcgcgcttc
gagcggctgctcgaggtggtcggcaacgagccggccgagctggcggcgggccgcgagcgc
taccgcttctatcgcgatcggggttacgctctgaacaaccacaagcagggcagctag

DBGET integrated database retrieval system