KEGG   Burkholderia stagnalis: WT74_20235Help
Entry
WT74_20235        CDS       T04885                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00061  Fatty acid biosynthesis
bstg00780  Biotin metabolism
bstg01100  Metabolic pathways
bstg01212  Fatty acid metabolism
Module
bstg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WT74_20235
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WT74_20235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bstg01004]
    WT74_20235
Enzymes [BR:bstg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     WT74_20235
Lipid biosynthesis proteins [BR:bstg01004]
 Fatty acid synthase
  Component type
   WT74_20235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH AfsA
Motif
Other DBs
NCBI-ProteinID: AOK55105
UniProt: A0A118MVP2
LinkDB All DBs
Position
3:complement(848205..848669)
Genome map
AA seq 154 aa AA seqDB search
MTAAIDTGTRLDAADVLRCLPHRAPFLFVDHAQVDAAGAAIVGHRTFQPDEPWFAGHFPG
DPLVPGVVLIEFVAQTANLLVGHLAGGEARCHLVGVRNARFLQPVRPAQAIEAHVRAGAD
GALPRAGGIATFDATVLRDGARCMSATVTIYLTQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccatcgataccggcacgcggctcgacgccgccgacgtgctgcgctgcctg
ccgcaccgcgcgccgttcctgttcgtcgatcacgcgcaggtggacgccgccggcgccgcg
atcgtcggccatcgcacgttccagcccgacgagccgtggttcgccgggcactttcccggc
gatccgctggtgccgggcgtcgtgctgatcgaattcgtcgcgcagacggccaacctgctg
gtcggccatctcgcgggcggcgaggcgcgctgccatctggtgggcgtgcgcaacgcgcgc
ttcctgcagccggtgcggccggcccaggcgatcgaggcgcacgtgcgcgcgggcgccgac
ggcgcgctgccgcgcgcgggcggcatcgcgacgttcgacgccaccgtgctgcgcgacggc
gcgcgctgcatgagcgccaccgtgaccatttatttgacgcagtaa

DBGET integrated database retrieval system