KEGG   Burkholderia stagnalis: WT74_22900Help
Entry
WT74_22900        CDS       T04885                                 

Definition
(GenBank) hemolysin D
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
bstg  Burkholderia stagnalis
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bstg02000]
    WT74_22900
Transporters [BR:bstg02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   WT74_22900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 HlyD Biotin_lipoyl Gemini_mov Tup_N DUF3954 CCSMST1
Motif
Other DBs
NCBI-ProteinID: AOK55638
LinkDB All DBs
Position
2:complement(599366..600457)
Genome map
AA seq 363 aa AA seqDB search
MDTTQTPVTRDAAPADTVAQQRRRVPWMKVAVLAVIAVVASAALYWTFVLRFEQSTDDAY
VGGNVTVLAPKVNGFVDQILVTDNQRVKAGDVLVQLDARDYDAKLAQATADVDGARAAVT
ELEAKQQLQHAVIGQQTAEKSASAAELTRAASDKSRYRELVKSDAVSNQIVERADADYSK
ASAAVDRSDAALLAAKRQLDVLGAQLADARARVNTALAAQRVAALNVEYTTIRSPVDGYV
GNRTGRVGMLASVGVPLLTIVPASGLWIDANFKEDQLKHMRAGDRVDVRLDASSVRLHGS
VDSVAPATGATFSVLPPENATGNFTKIVQRVPVRVHLDPQPGSENVLRPGLSAVVTVHTD
HAN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggatacgacgcagactcctgttacccgcgacgcggcacctgccgacactgtcgcgcag
caacgccggcgcgtgccgtggatgaaggtcgcggtgctggccgtgatcgcggtggtcgcg
tcggcggcgctctactggactttcgtgctgcgcttcgagcaaagcacggacgatgcctat
gtgggcggcaacgtcacggtgctcgcgccgaaggtcaacggcttcgtcgaccagatcctc
gtaaccgacaaccagcgcgtgaaggccggcgacgtgctggtgcagctcgatgcgcgcgac
tacgatgcgaagctcgcgcaggcgacggccgacgtcgacggcgcgcgcgccgcggtgacc
gagctcgaagcgaagcagcagttgcagcacgcggtgatcggccagcagaccgcggaaaaa
agcgcgtcggcggcggagctgacccgcgccgcgtccgacaagtcgcgctaccgcgaactc
gtgaaatccgacgcggtgtcgaaccagatcgtcgaacgcgcggatgccgactattcgaag
gcgagcgccgcggtcgatcgcagcgacgccgcgctgctcgccgcgaaacgtcagctcgac
gtgctcggcgcgcagctcgccgacgcccgcgcgcgcgtcaataccgcgctcgccgcacag
cgggtggcggcgctcaacgtcgaatacacgacgatccgctcgccggtcgacggctacgtc
ggcaaccgcaccggccgggtcgggatgctcgcgagcgtcggcgtgccgctgctcacgatc
gtccccgcgtcgggcctgtggatcgacgcgaacttcaaggaagaccagctcaagcacatg
cgcgcgggcgaccgcgtcgacgtgcggctcgacgcgtcgagcgtgcgcctgcacggcagc
gtcgacagcgtcgcgcccgcgaccggcgcgaccttcagcgtgctgccgccggagaacgcg
accggcaacttcacgaagatcgtgcagcgcgtgccggtgcgcgtgcatctcgacccgcag
ccgggcagcgagaacgtgctgcgcccgggcctgtccgcggtcgtgaccgtgcacaccgat
cacgcgaactga

DBGET integrated database retrieval system