KEGG   Burkholderia stagnalis: WT74_23095Help
Entry
WT74_23095        CDS       T04885                                 

Definition
(GenBank) anthranilate 1,2-dioxygenase
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00627  Aminobenzoate degradation
bstg01100  Metabolic pathways
bstg01120  Microbial metabolism in diverse environments
Module
bstg_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    WT74_23095
Enzymes [BR:bstg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     WT74_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 NTF2 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: AOK55673
UniProt: A0A3N7U8B9
LinkDB All DBs
Position
2:649061..649537
Genome map
AA seq 158 aa AA seqDB search
MMEDMKTWFEVTMLQNRYIGHLDNDRLEQWPEMFTEDCTYEIVPKENADLGLPVGIVHCT
NQRMLRDRVVSLRHANIFEEHTYRHMTSGLTIVAERDGEIDTESNYVVVQTRSNGESNVY
QAGKYYDTVVRTPDGLRYKTKRVIYDTSRVQTLLATPI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagacatgaagacgtggttcgaggtgaccatgttgcagaaccgttacatcggc
cacctcgacaacgatcggctcgaacagtggccggagatgttcaccgaggattgcacgtac
gagatcgtgccgaaggagaacgccgacctcgggctgccggtcgggatcgttcattgcacg
aaccagcggatgctgcgcgaccgcgtggtgtcgctgcggcacgcgaacatcttcgaggag
cacacgtaccggcacatgacgtcgggcctgacgatcgtcgcggagcgcgacggcgagatc
gacaccgagagcaactacgtggtcgtgcagacgcgcagcaacggcgaatcgaacgtctac
caggccggcaagtactacgacacggtggtgcgcacgcccgacgggctgcgctacaagacg
aagcgcgtgatctacgacacgtcgcgcgtgcagacgctgctcgccaccccgatctga

DBGET integrated database retrieval system