KEGG   Burkholderia stagnalis: WT74_24885Help
Entry
WT74_24885        CDS       T04885                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bstg  Burkholderia stagnalis
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WT74_24885
Enzymes [BR:bstg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WT74_24885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like K_oxygenase Glutaredoxin Thi4 NAD_binding_8 FAD_oxidored FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AOK55990
LinkDB All DBs
Position
2:complement(1054680..1056275)
Genome map
AA seq 531 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELFALLNEIASLTARVTVVERRGDAE
RTPSFTIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGET
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPTFATALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLVEYGAQLRADEVLQRKLRSLSNVTVVTQAQTTELTGDGSKL
NGLVYTDRQTGDVKRIELEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAAAAPRPRAEEAVAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcgtcgctggacgacagcgcgaagtcgcaggagctgtttgcgctgctg
aacgagattgcgtcgctgacggctcgcgtgaccgtcgtcgaacgccgcggcgatgccgag
cgcacgccgtcgttcacgatcggcgaaccgggcaagccggccggcatccgtttcgccggc
atcccgatgggccacgagttcacgtcgctcgtgctcgcgctgctgcagacgggcggccac
ccgatcaagctcgacgacgacgtgatcgagcagatccgcgcgctcgacggcgattacgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gatgaagtcgaggcgcgccagatcatggcggtgccgaccatgttcctgaacggcgaaacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacacgggcgccggc
gcccgcgccgcgaagtcgctcgagaacaagcccgtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggcggccgcgatctactcggcgcgcaagggcattgcgacgggcgtc
gtggccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgacgttcgcgacggcgctcgagcagcacgtgaagcaatac
gacgtcgacatcatggacgtgcaacgcgccgaggcactgattcccggcgacgtgcaccag
atccgcctcgcgaacggcgccgtgctgaaggcgaagacgatcgtgctcgccaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtggaagccgcgatcgacctggccggcatcgtgaaggaagtcacgctggtc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgtcg
aacgtgaccgtcgtcacgcaggcccagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacacggatcgtcaaacgggcgacgtgaagcgcatcgagctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacgatcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcctcgctcggcgcgttcgatcacctgatccggcaggatgtcgcggcggccgcg
ccgcggccgcgggccgaggaagccgtggccgcgtaa

DBGET integrated database retrieval system