KEGG   Burkholderia stagnalis: WT74_25015
Entry
WT74_25015        CDS       T04885                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00440  Phosphonate and phosphinate metabolism
bstg00998  Biosynthesis of various secondary metabolites - part 2
bstg01100  Metabolic pathways
bstg01110  Biosynthesis of secondary metabolites
bstg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WT74_25015
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    WT74_25015
Enzymes [BR:bstg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WT74_25015
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AOK56011
UniProt: A0A104V6N8
LinkDB
Position
2:complement(1090668..1092356)
AA seq 562 aa
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELTSLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTQPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAEGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARPDFDTLDIPTLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGIGGAQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaagcgggcttcaagggcatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaggcgagctggacccaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgatacgggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcgtccgcgatgcaggccgtcgcgcgcgag
atccacgagaacgagacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctggaagcc
gtcaccgaagacaagcccaaggtcatgctgccggtggccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtggtgggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcagacg
ggcgagctcacgtcgctcgcgtgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgacgcagccgaccaaccagagcgtgcgcgacttc
gcgctctgctcggccgccgacgaccgcggcctgttcggccagaagacctacttgcagcgc
gtatcgagcgacgtcgccgaaggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcaggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgccctgat
ttcgacacgctcgacatccccacgctcctcaacgagctgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctggaagatttccgtcgc
gcgggcgacttcgcgcacggccagacgccgctgtccgaaccgggcgccggcatcggaggc
gcgcaatga

DBGET integrated database retrieval system