KEGG   Burkholderia stagnalis: WT74_31640Help
Entry
WT74_31640        CDS       T04885                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00250  Alanine, aspartate and glutamate metabolism
bstg00410  beta-Alanine metabolism
bstg00640  Propanoate metabolism
bstg00650  Butanoate metabolism
bstg01100  Metabolic pathways
bstg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bstg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WT74_31640
   00650 Butanoate metabolism
    WT74_31640
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WT74_31640
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WT74_31640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bstg01007]
    WT74_31640
Enzymes [BR:bstg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WT74_31640
Amino acid related enzymes [BR:bstg01007]
 Aminotransferase (transaminase)
  Class III
   WT74_31640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOK57164
UniProt: A0A108A5R9
LinkDB All DBs
Position
2:2690481..2691770
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENSELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINARAPGDFTKKTAFFTTGAEAVENAV
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVQADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgatctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacagcgagctgtgggacgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccac
ccgaagatcgtcaaggcgatcgccgaccagctgaacaacttcacgcacacggcgtaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgagaagatcaacgcccgcgcgccgggc
gacttcacgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcggtc
aagatcgcgcgcgcggccaccggccgtccgggcgtgatcgccttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtgcagggcgaaggcggcttcaacccggcgccggcg
gaattcgtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtccagacgggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtg
caggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggcggctcccggcggcctcggcggcacgtatgcg
ggcaacccgctggccgtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgcgacgcagctcggcgacgtgctgaaggccaagctgaacgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggctcgggcgagccggacgccgatttcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgtcatcctggaagaagtg
ttgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system