KEGG   Burkholderia stagnalis: WT74_31710Help
Entry
WT74_31710        CDS       T04885                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bstg  Burkholderia stagnalis
Pathway
bstg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bstg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    WT74_31710
Enzymes [BR:bstg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WT74_31710
Transporters [BR:bstg02000]
 Other Transporters
  Pores ion channels [TC:1]
   WT74_31710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 SPOB_a
Motif
Other DBs
NCBI-ProteinID: AOK57176
LinkDB All DBs
Position
2:complement(2709643..2710260)
Genome map
AA seq 205 aa AA seqDB search
MKLYGFPGTRTQRALWGLKELDANFEFVSVNLLQGEHKRPEFLRLNPAGKVPVLVDGDLV
IPESAAIVLYLADKYPEKALLPVDLAGRAQVYRWVMFAVTELEQPLWRITRHTMLYPPEK
RLPADIALARDDFIAMAAILDAHLEGRRFIVGDTLTIADCVTAYLIDWANELKLIDGFPQ
LRAYLERLYARPKAPQRIAEAFKAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacggattccccggaacgcgcacgcagcgcgcgctatgggggctcaaggag
ctcgacgcgaatttcgagttcgtctcggtcaacctgctccagggcgagcacaagcggccc
gaattccttcgcctcaaccccgcgggcaaggtgcccgtgctggtggacggcgacctcgtg
attcccgagtcggccgcgatcgtgctgtatctcgcggacaagtacccggagaaggcgctg
ctgccggtcgacctggccgggcgggcgcaggtctatcgctgggtgatgttcgcggtcacg
gagctcgagcagccgctatggaggatcacgcggcatacgatgctctacccgccggagaag
cgcctgccggccgatatcgcgctggcgcgggacgacttcatcgcgatggccgcgatcctc
gacgcccatctcgaagggcgccggttcatcgtcggcgacacgctgacgatcgccgactgc
gtgacggcctatctgatcgactgggccaacgaactgaagctgatcgacgggttcccgcaa
ttgcgcgcgtatctcgaacgcctgtatgcgcggccgaaggcgccgcagcgcatcgccgag
gcgttcaaggcggcgtga

DBGET integrated database retrieval system