KEGG   Burkholderia stabilis: BBJ41_02625
Entry
BBJ41_02625       CDS       T04946                                 

Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bstl  Burkholderia stabilis
Pathway
bstl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BBJ41_02625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bstl03011]
    BBJ41_02625
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_02625
Ribosome [BR:bstl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BBJ41_02625
  Bacteria
    BBJ41_02625
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_02625
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: AOR66540
UniProt: A0A1D7Z9C5
LinkDB
Position
1:544844..545218
AA seq 124 aa
MRHYEIVFIVHPDQSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHYV
CMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKAAAAQPT
EAQA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcgtcattacgaaatcgtattcatcgtgcaccccgatcagagcgagcaagtgcccgca
atgatcgagcgttacaagaccacgatcacgtcgcacggcggtcagatccaccgcgtcgaa
gactggggccgtcgccaactggcctacatgatcgagaaactcgcgaaggctcactacgtc
tgcatgaacatcgagtgcgaccagacgacgctcgacgaactcgaacacgcgttcaagttc
aacgacgccgtgctgcgccacctcatcgtcaagatgaagaaggccgaaaccggcccgtcg
ccgatgatgaaggaagttcagcgcgaagaagccaagaaggcggctgcagctcagccgacc
gaagcgcaggcttaa

DBGET integrated database retrieval system