KEGG   Burkholderia stabilis: BBJ41_06465
Entry
BBJ41_06465       CDS       T04946                                 

Definition
(GenBank) GTPase Era
  KO
K03595  GTPase
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bstl03009]
    BBJ41_06465
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_06465
Ribosome biogenesis [BR:bstl03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   BBJ41_06465
 Prokaryotic type
  GTPases
   BBJ41_06465
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_06465
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N AIG1 Dynamin_N RsgA_GTPase GTP_EFTU AAA_22 Ras PduV-EutP SRPRB Roc KH_1 MMR_HSR1_Xtn Septin Ploopntkinase3 AAA_18 ABC_tran RNA_helicase
Other DBs
NCBI-ProteinID: AOR67218
UniProt: A0A1D7ZBE2
LinkDB
Position
1:complement(1398213..1399112)
AA seq 299 aa
MNTPAPTGFRCGMIAIVGRPNVGKSTLMNELVGQKISITSRKAQTTRHRITGINTFDDAQ
FVFVDTPGFQTRHSTALNRSLNRAVTSTLTSVDVILFVIEAGRFGPDDQKVLDLIPPGMP
TLLITNKIDRVNDKATLYPFMQKMNALREFVELVPLSAKQPEDIKRLLETIKPYLPEGEP
IYGEDELTDRSSRFLAAEILREKVFRWTGDELPYTSTVVIDKFEEEGRLKRVFATILVER
DSHKAMVIGKKGEKLKQISTEARMDMEKLFDGPVYLETFVKVRSGWADNEAGLRAYGYE
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaacactcccgctcctaccggtttccgttgcggcatgatcgcgatcgtgggccgcccg
aacgtcggcaagtcgacgttgatgaacgaactcgtcggccagaagatcagcatcacgtcg
cgcaaggcgcagacgacccgccaccgtatcaccggcatcaatacgttcgacgacgcccag
ttcgtgttcgtcgatacgccgggtttccagacgcgccacagcaccgcgctgaaccgttcg
ctgaaccgcgcggtcacgtcgacgctgacgtcggtcgacgtgatcctgttcgtgatcgag
gccggccgcttcgggcccgacgaccagaaggtgctcgacctgatcccgccgggcatgccg
acgctgctgatcacgaacaagatcgaccgcgtcaacgacaaggcgacgctgtatccgttt
atgcagaagatgaacgcgctgcgcgaattcgtcgagctcgtgccgctgtcggcgaagcag
ccggaagacatcaagcgtctgctcgagacgatcaagccgtacctgccggaaggcgagccg
atctacggcgaggacgagctcaccgatcgcagctcgcgtttcctcgcggccgagatcctg
cgcgagaaggtgttccgctggaccggcgacgagctgccgtacacgagcaccgtcgtgatc
gacaagttcgaggaagaagggcgcctgaagcgcgtcttcgcgacgatcctcgtcgagcgc
gattcgcacaaggcgatggtgatcggcaagaagggcgagaagctcaagcagatcagcacc
gaggcgcggatggacatggagaagctgttcgacggccccgtgtacctcgagaccttcgtg
aaggtgagaagcggctgggccgacaacgaggcggggctgcgcgcctatgggtacgaatga

DBGET integrated database retrieval system