KEGG   Burkholderia stabilis: BBJ41_06545
Entry
BBJ41_06545       CDS       T04946                                 

Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
bstl  Burkholderia stabilis
Pathway
bstl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BBJ41_06545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bstl03011]
    BBJ41_06545
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_06545
Ribosome [BR:bstl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BBJ41_06545
  Bacteria
    BBJ41_06545
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_06545
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: AOR67234
UniProt: A0A1D7ZBG8
LinkDB
Position
1:complement(1413947..1414126)
AA seq 59 aa
MAVQQNKKSPSKRGMHRSHDFLTASPLAVEPSTGEVHLRHHVSPNGYYRGKKVVKTKND
NT seq 180 nt   +upstreamnt  +downstreamnt
atggcagtccagcaaaacaagaagtcgccgtcgaagcgcggcatgcatcgttcgcacgat
ttcctgacggcatcgccgctggcagtcgagccgagcacgggtgaagtgcatctgcgtcac
cacgtcagcccgaacggctactatcgcggcaagaaagtcgtcaagacgaagaacgactaa

DBGET integrated database retrieval system