KEGG   Burkholderia stabilis: BBJ41_06805
Entry
BBJ41_06805       CDS       T04946                                 

Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
bstl  Burkholderia stabilis
Pathway
bstl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BBJ41_06805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bstl03011]
    BBJ41_06805
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_06805
Ribosome [BR:bstl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BBJ41_06805
  Bacteria
    BBJ41_06805
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_06805
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: AOR67281
UniProt: A0A1D7ZBJ0
LinkDB
Position
1:complement(1462390..1462644)
AA seq 84 aa
MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATKGESLRIAQDRLTYWQ
GVGAQLSPTVQRLVKEAQKAQPAA
NT seq 255 nt   +upstreamnt  +downstreamnt
atggttatcatccgtctggctcgtggcggctcgaagaagcgcccgttctacaacatcgtt
gctaccgattcgcgtaaccgtcgtgacggccgcttcatcgagcgcgtcggcttctacaac
ccggttgccacgaagggcgaatcgctgcgtatcgctcaggatcgcctgacgtactggcaa
ggcgttggcgcgcaactgtcgccgaccgtccagcgtctcgtgaaggaagcgcaaaaggcg
caaccggctgcctaa

DBGET integrated database retrieval system