KEGG   Burkholderia stabilis: BBJ41_07050
Entry
BBJ41_07050       CDS       T04946                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00970  Aminoacyl-tRNA biosynthesis
bstl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBJ41_07050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_07050
Enzymes [BR:bstl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_07050
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_07050
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_07050
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AOR67324
UniProt: A0A1D7ZBQ7
LinkDB
Position
1:1515955..1517328
AA seq 457 aa
MTTFTPFPPLAQLAADLAAGRTTSRALVDTALDRIADPSGQGAVVFTEVDADNARAAADA
HDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLDGAPAASTDAVAVARLKRAGA
VLVGRTNMSEFAFSGLGLNPHFGNPRSPYHRDVPGDARISGGSSSGAGASVADGMAAVAL
GTDTGGSIRIPAALCGLTGFKPTASRIPTQGGVPLSTTLDSFGPIGLSVACCALVDRMLA
GLEPHVPAARPLEGVRLGVLTNYVTDGVDADVAAALDTALKHLEAAGAIVTEVRFPALDR
LPDINRFGFSPIEAYAWHRPLLAQHRDQYDPRVLTRILKGEPASAADYLDLLAARTAMLD
EAAHTVWARFDALVAPTVPVVPPRIADLEADDAFTRTNALILRNPSAFNFLDACSLSLPC
HPRDAAPVGLMLAAAPHRDDALLSIGQSVEAVLNTIR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaccactttcacgcccttccccccgctcgcccagctcgccgccgacctcgccgccggc
cggaccacgagccgcgcgctcgtcgacaccgcgctcgaccggatcgccgatccgtcgggc
cagggcgccgtcgtcttcaccgaagtcgatgccgacaacgcgcgcgccgccgccgacgca
cacgaccgcctgcgcgccgcgggcaccgtgttgtcgccgctcgcgggcatccccgtgtcg
gtcaaggacctgttcgacgtcgcgggccaggtgacgcgcgccggttcgcgcgtgctcgac
ggcgcgccggccgccagcaccgacgcagtcgcggtcgcacggctcaagcgggcgggcgcg
gtgctggtcggccgcacgaacatgagcgagttcgcgttctcggggctcgggctgaatccg
cacttcggcaatccgcgctcgccgtaccaccgcgacgtgccgggcgatgcacggatttcc
ggcggctcgtcgtcgggtgcgggcgcatcggtcgccgacgggatggctgccgtcgcgctc
ggcaccgacacgggcggctcgatccgcattccggccgcgctgtgcgggctgacgggcttc
aagccgaccgcgagccggattccgacgcaaggcggcgtgccgctgtcgacgacgctcgac
tcgttcgggccgatcggcctgtccgtcgcatgctgcgcgctcgtcgaccggatgctcgcg
ggcctggagccgcacgtgccggccgcgcggccgctcgaaggcgtgcggctcggcgtgctg
acgaactacgtgaccgatggtgtcgatgccgacgtcgcggccgcgctcgacaccgcgctc
aagcatctcgaagccgccggcgcgatcgtcacggaggtgcgcttccccgcgctcgaccgg
ctgccggacatcaaccgcttcggcttctcgccgatcgaggcgtacgcgtggcatcgcccg
ctgctcgcgcagcatcgcgaccagtacgacccgcgcgtactcacccgcatcctgaaaggc
gagcccgcgagcgcggccgattatctcgacctgctcgccgcgcgcaccgcgatgctcgac
gaggccgcgcacaccgtctgggcgcgcttcgatgcactcgttgcgccgacggtgccggtc
gtgccgccgcgaatcgccgacctcgaagcggacgacgcgttcacgcgcaccaatgcgctg
atcctgcgcaacccgagcgcgttcaacttcctcgacgcgtgctcgctgtcgctgccgtgc
cacccgcgcgacgcggcaccggtcggcctgatgctcgcggcggcgccgcatcgcgacgac
gcgctgctctcgatcggccagtcggtcgaggccgtgctcaatacgatccgctga

DBGET integrated database retrieval system