KEGG   Burkholderia stabilis: BBJ41_11385Help
Entry
BBJ41_11385       CDS       T04946                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bstl  Burkholderia stabilis
Brite
Translation factors [BR:bstl03012]
 Eukaryotic Type
  Elongation factors
   BBJ41_11385
 Prokaryotic Type
   BBJ41_11385
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BBJ41_11385
Exosome [BR:bstl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBJ41_11385
  Exosomal proteins of breast cancer cells
   BBJ41_11385
  Exosomal proteins of colorectal cancer cells
   BBJ41_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29 AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: AOR68085
UniProt: A0A1D7ZE34
LinkDB All DBs
Position
1:2442268..2443458
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtaaattcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccatggcaagacgacgctgacggcagcgatcacgacggttctgacgaagaagttc
ggcggcgaagcgaaggcgtacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgagcctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcagttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcatcgtgaag
gtcggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaagcaggcgacaacgttggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system