KEGG   Burkholderia stabilis: BBJ41_13040
Entry
BBJ41_13040       CDS       T04946                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00970  Aminoacyl-tRNA biosynthesis
bstl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBJ41_13040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_13040
Enzymes [BR:bstl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_13040
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_13040
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_13040
SSDB
Motif
Pfam: Glu-tRNAGln DUF2120
Other DBs
NCBI-ProteinID: AOR68373
UniProt: A0A1D7ZEQ3
LinkDB
Position
1:2802123..2802422
AA seq 99 aa
MALNLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQ
EVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE
NT seq 300 nt   +upstreamnt  +downstreamnt
atggccctgaacctgaccgatgtgaaacgcatcgcgcacctggcgcgactcgaaatggcc
gacgccgacgccgagcacatgctcggccagctcaatgaattcttcggcctcgtcgaacag
atgcaggcggtcgacactgccggcatcgcgccgctcgcccacccgatcgaacagatccag
gaagtcgcgcagcgcctgcgcgacgacgccgtgacggaagtcgtcaatcgcgacgacaac
cagcgtccggcgccggccgtccaggacggcctctatctcgtgccgaaggtgatcgagtaa

DBGET integrated database retrieval system