KEGG   Burkholderia stabilis: BBJ41_13045Help
Entry
BBJ41_13045       CDS       T04946                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00970  Aminoacyl-tRNA biosynthesis
bstl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBJ41_13045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_13045
Enzymes [BR:bstl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_13045
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBJ41_13045
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOR68374
UniProt: A0A1D7ZES4
LinkDB All DBs
Position
1:2802492..2803982
Genome map
AA seq 496 aa AA seqDB search
MHEKSLTELRAALAAKECSAVELAQHYLKRIDAARGLNAFVHVDADLTLAQAKAADAELA
RGAGGALTGLPIAHKDVFVTRGWRSTAGSKMLANYESPFDATVVARLQAAGMVTLGKTNM
DEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARIAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALLLNAMAGFDERDSTSLERD
DEDFTRHLGQPWAAGNDAGKPLAGLRIGLPNEYFGEGLADDVRATIDAALKQYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAQYGDLLDMYKKSRAEGFGPE
VKRRILVGAYVLSHGYYDAYYLQAQKIRRIIANDFQEAFKSCDVIMGPASPTVAWDLGAK
GDDPVAMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFNEARMLQVAD
AFQRATDWHKQVPAGV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaaaaagcctgaccgaactgcgcgccgcgctcgccgccaaggaatgctcggcc
gtcgagctcgcgcagcactacctgaaacggatcgacgccgcacgcggcctgaacgcgttc
gtccacgtcgacgccgatctgaccctcgcgcaggcgaaggccgccgatgccgagctcgcg
cgcggcgcgggcggcgcgctgaccggcctgccgatcgcgcacaaggatgtcttcgtcacg
cgcggctggcgctcgaccgccggctcgaagatgctcgcgaattacgagagcccgttcgac
gcgaccgtcgtcgcccgcctgcaggcggccggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaattccgcgttcggcgcggtgaagaacccg
tgggacaccaacgcggtgccgggcggcagctcgggcggcagctcggccgccgtcgccgcg
cgcatcgcgccggccgcgaccggcaccgacaccggcggctcgatccgccagcccgcgtcg
ttcgcgggcgtgacgggcatcaagccgacctacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgatcagggcggcccgatggcgcagagcgcgtccgactgcgcg
ctgctgctcaacgcgatggccggcttcgacgagcgcgactcgacgagcctcgagcgcgac
gacgaggatttcacgcgccacctcggccagccgtgggcggccggcaacgatgcgggcaag
ccgctcgcgggcctgcgcatcggcttgccgaacgagtatttcggcgaaggcctcgccgac
gacgtgcgcgcgacgatcgacgccgcattgaagcagtatgaagcgctcggcgcgacgctc
gtgcccgtgtcgctgccgaagacggaactgtcgatccccgtgtattacgtgatcgcgccg
gccgaggcgtcgtcgaacctgtcgcgtttcgacggcgtgcgcttcggccaccgcgccgcg
cagtacggcgatctgctcgacatgtacaagaagtcgcgcgccgaaggcttcggccccgag
gtgaagcgccggattctcgtcggcgcgtacgtgctgtcgcacggctactacgacgcgtac
tacctgcaggcgcagaagatccgccgcatcatcgcgaacgatttccaggaagcgttcaag
tcctgcgacgtgatcatgggcccggcgtcgccgacggtcgcatgggatctcggcgcgaag
ggcgacgatccggtggcgatgtatctcgcggatatctacacgctgtcggtgagcctcgcc
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcggtctgcagatcatcggcaactatttcaacgaagcccggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgattggcacaagcaagttccggcaggggtgtaa

DBGET integrated database retrieval system