KEGG   Burkholderia stabilis: BBJ41_13850Help
Entry
BBJ41_13850       CDS       T04946                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBJ41_13850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bstl02000]
    BBJ41_13850
Enzymes [BR:bstl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BBJ41_13850
Transporters [BR:bstl02000]
 Other Transporters
  Pores ion channels [TC:1]
   BBJ41_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2
Motif
Other DBs
NCBI-ProteinID: AOR68520
UniProt: A0A1D7ZF70
LinkDB All DBs
Position
1:2966523..2967161
Genome map
AA seq 212 aa AA seqDB search
MNAYRLYLSPGACSLAAHIALEETGAPFDVEIVSVHKQQNLEARYLVINAKARVPALAIP
GEPRALTETPAILTYLARRHPDAQLLPLGDPLREARCHEWLAWLVGWVHGVGYGALWRPG
RFIGDPALHDAISTHGRGVIDAANVAIEAAFADGRTWAEPGAHSIVDPFLLVLYRWGVAI
GFDMTRHPAWTAHAQREAERPAARRALAREAA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatatcgtctctatctttcgccgggcgcctgctcgcttgcggctcacatcgcg
ctggaggaaaccggcgcgccgttcgacgtcgagatcgtctccgtgcacaagcagcagaac
ctcgaggcgcgttatctcgtgatcaacgcgaaggcgcgcgtgcccgcgctcgcgattccg
ggcgagccgcgcgcgctgacggaaacacccgcgatcctcacgtacctcgcgcgccgtcat
ccggacgcgcaactgctgccgctcggcgatccgctgcgcgaggcgcggtgccacgaatgg
ctcgcctggctggtcggctgggtgcatggcgtcggctacggcgcgctgtggcgcccgggc
cgcttcatcggcgatccggcgctgcacgatgcgatcagcacgcacgggcgcggcgtgatc
gatgccgcgaacgtggcgatcgaagccgcattcgccgacggccgcacgtgggccgagccg
ggcgcgcattcgatcgtcgatccgttcctgctcgtgctgtatcgctggggtgtcgcgatc
ggattcgacatgacgcggcatcccgcgtggaccgcccatgcgcagcgcgaggccgagcgg
ccggctgcgcggcgtgcgctggcgcgcgaggcggcctga

DBGET integrated database retrieval system