KEGG   Burkholderia stabilis: BBJ41_15150
Entry
BBJ41_15150       CDS       T04946                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBJ41_15150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bstl01007]
    BBJ41_15150
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bstl03016]
    BBJ41_15150
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_15150
Enzymes [BR:bstl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BBJ41_15150
Amino acid related enzymes [BR:bstl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BBJ41_15150
Transfer RNA biogenesis [BR:bstl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBJ41_15150
 Prokaryotic type
   Other AARSs
    BBJ41_15150
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_15150
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d tRNA_anti-like
Other DBs
NCBI-ProteinID: AOR68750
UniProt: A0A1D7ZFU8
LinkDB
Position
1:3248531..3250333
AA seq 600 aa
MSMRTEYCGLVTEHLLGQTVSLCGWVQRRRDHGGVIFIDLRDREGLVQVVCDPDRAEMFA
TAEGVRNEFCVQIKGLVRNRPDGTVNAGLKSGKIEVLCHELNVLNASVTPPFQLDDDNLS
ETTRLTHRVLDLRRPQMQHNLRLRYRVAIEARKYLDEQGFIDIETPMLTKSTPEGARDYL
VPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDEDLRADRQPEFTQIDCETS
FLGEQEIRDLFEDMIRHIFKTTIDVELDAKFPVMPYSEAMARFGSDKPDLRVQLEFTELT
DAMKDVDFKVFSTPANAKDGRVAALRVPKGSELSRGDIDGYTEFVRIYGAKGLAWIKVNE
KAKGRDGLQSPIVKNLHDASIAAILERTGAEDGDIIFFAADRAKVVNDSLGALRLKIGHS
EFGKANGLVQAGWKPLWVVDFPMFEYDDEDARYVAAHHPFTSPKDEHLEYLETDPGRCLA
KAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKIGAEEAQLKFGFLLDALQYGAPPHGGI
AFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQAPSPVDERQLRELHIRLRQPEQPKA
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtcgatgcgtactgaatactgcggtctcgtgaccgaacacctgctgggccaaaccgtg
tcgctgtgcggctgggtgcagcgccgccgcgatcacggcggtgtgatcttcatcgacctg
cgcgatcgtgaaggcctcgtgcaggtggtgtgcgacccggatcgcgcggagatgttcgcg
accgccgaaggcgtgcgcaacgagttctgcgtgcagatcaagggcctcgtgcgcaaccgt
ccggacggcacggtcaacgccggcctgaagagcggcaagatcgaagtgctgtgccacgaa
ttgaacgtgctgaacgcatcggtcacgccgccgttccagctcgacgacgacaacctgtcg
gaaacgacgcgcctcacgcaccgcgtgctcgacctgcgccgtccgcagatgcagcacaac
ctgcgcctgcgctaccgcgtcgcgatcgaggcgcgcaagtacctcgacgagcagggcttc
atcgacatcgaaacgccgatgctcacgaagagcacgccggaaggcgcgcgcgactacctc
gtgccgtcgcgcgtgaacgcaggtcagttcttcgcgctgccgcagtcgccgcagctgttc
aagcagctgctgatggtcgcgaacttcgaccgctactaccagatcaccaagtgcttccgc
gacgaagaccttcgcgccgatcggcagccggaattcacgcagatcgactgcgagacgtcg
ttcctcggcgagcaggaaattcgtgacctgttcgaagacatgatccgtcacatcttcaag
acgacgatcgacgtcgagctcgacgcgaaattcccggtgatgccgtactcggaagcgatg
gcgcgtttcggctcggacaagccggacctgcgcgtgcagctcgaattcaccgagctgacc
gacgcgatgaaggacgtcgatttcaaggtgttcagcacgccggccaacgcgaaggacggc
cgtgtcgcggcgctgcgcgtgccgaagggcagcgagctgtcgcgcggcgacatcgacggt
tacacggaattcgtgcgcatctacggcgcgaagggcctcgcatggatcaaggtcaacgag
aaggcgaagggccgcgacggcctgcagagcccgatcgtcaagaacctgcacgacgcatcg
atcgcggcgatcctcgagcgcaccggcgctgaagacggcgacatcatcttcttcgcggcc
gaccgcgcgaaggtggtcaacgacagcctcggcgcgctgcgcctgaagatcggccattcg
gaattcggcaaggccaacggcctcgtccaggccggctggaagccgctgtgggtcgtcgac
ttcccgatgttcgaatacgacgacgaagatgcgcgctacgtcgctgcccaccacccgttc
acgagcccgaaggacgagcacctcgagtacctcgagaccgatccgggccgctgcctcgcg
aaggcatacgacatggtgctgaacggctgggaaatcggcggcggctcggtgcgtatccac
cgcgaggaagtgcagagcaaggtgttccgcgcgctgaagatcggcgcggaagaagcccag
ctgaaattcggcttcctgctggacgcgctgcagtacggcgcgccgccgcacggcggtatc
gcattcggtctcgaccgcatcgtcacgatgatggccggcgccgattcgatccgcgacgtg
atcgcgttcccgaagacgcagcgtgcgcaggatctgctcacgcaagcgccgagcccggtc
gacgagcgtcaactgcgcgaactgcacatccgtctgcgtcagccggagcagccgaaggcg
taa

DBGET integrated database retrieval system