KEGG   Burkholderia stabilis: BBJ41_20920Help
Entry
BBJ41_20920       CDS       T04946                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bstl02022]
    BBJ41_20920
Two-component system [BR:bstl02022]
 OmpR family
  Unclassified
   BBJ41_20920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AOR70051
UniProt: A0A1D7ZJL3
LinkDB All DBs
Position
2:641993..642706
Genome map
AA seq 237 aa AA seqDB search
MDHILVVDDDPNIRTLLGDYLRGMNYRVTLAENGLQLRQALGTASVDLVVLDLMLDGEDG
LDLTRDLRQRHDVPIVILSARGGLLDRILGLEMGADDYLPKPFDPRELVAKIKVVLRRTR
AIPGARRTEASSLVSFAGWQLDTRMKQMMSPDGVVVSLGGSDYRTLRALLDHPNRPLSRE
FLLDRVFGKELAPLDRSIDVCVSRLRHHLKDAARNAALIRTVRNEGYMLVADVVHEA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaccacatccttgtcgtcgacgacgatccgaacatccgtacgctgctcggcgactac
ctgcgcggcatgaactaccgcgtcacgctggccgagaacggcttgcagcttcggcaggcg
ctcggtacggcgagcgtcgatctcgtcgtgctcgacctgatgctcgacggcgaggacggc
ctcgatctcacccgcgacctgcggcagcgccacgacgtgccgatcgtgatcctgagcgcg
cgcggcggcctgctcgaccggatcctcggcctcgagatgggcgcggacgactacctgccg
aagccgttcgatccgcgcgagctcgtcgcgaagatcaaggtcgtgctgcgccgcacgcgc
gcgattcctggcgcccggcgcaccgaggcgtcgtcgctcgtcagcttcgcgggctggcaa
ctcgatacgcggatgaagcagatgatgtcgcccgacggggtcgtcgtgtcgctcggcggc
tcggactaccgcacgttgcgcgcgctgctcgatcacccgaaccgcccgctgtcacgcgaa
ttcctgctcgatcgcgtgttcggcaaggagctcgcgccgctcgatcgctcgatcgacgtg
tgcgtgagccggctgcgccaccacttgaaagatgccgcgcgcaacgcggcgctgatccgc
acggtccgcaacgagggctacatgctcgtcgcggacgtcgtgcacgaagcgtga

DBGET integrated database retrieval system