KEGG   Burkholderia stabilis: BBJ41_21875Help
Entry
BBJ41_21875       CDS       T04946                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBJ41_21875
Enzymes [BR:bstl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BBJ41_21875
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BBJ41_21875
    1.1.1.-  
     BBJ41_21875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO
Motif
Other DBs
NCBI-ProteinID: AOR70220
UniProt: A0A1D7ZK35
LinkDB All DBs
Position
2:850083..851147
Genome map
AA seq 354 aa AA seqDB search
MKAAVWRGRRDIRVEEVPVPAHPPAGWVTIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAELGAGVTGFAPGDRVTADACQHCGTCWYCTHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPDNFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASVVIDPKTSDAIAEVKALTGGY
GADVSFECIGHTATAKLAIDVIRKAGKSVMVGIFEEPTPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVAHGFEELVNHKDRNVKIIVQPAVS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcgcggccgccgcgacatccgcgtcgaagaggttcccgttccg
gcgcacccgccggcaggctgggtcacgattcgcgtccactggtgcgggatatgcggctcc
gacctgcacgaatatgtcgccggccccgtgttcatcccggtcgatgcgccgcatccgctg
acgggcctgaaaggccagtgcatcctcggccacgagttcagcggcgagatcgccgaactc
ggcgcgggcgtgacgggtttcgcgcccggcgaccgcgtgaccgccgacgcttgccagcat
tgcggcacatgctggtattgcacgcacgggctgtacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggcgcgttcgccgaatacgtgaacgtgcccgccgagttgctg
tacaagctgcctgacaacttcccgaccgaggccggcgcgctgatcgagccgctcgcggtc
ggactgcatgcggtgaagaaggcgggcaacatcgtcgggcagaccgtcgtggtcgtcggc
gcgggcacgatcggcctgtgcacgatcatgtgcgcgaaggccgcgggcgccggacgcgtg
atcgcgctggagatgtcggccgcgcgcaagcagaaggcgctggaagtcggcgcgagcgtc
gtcatcgatccgaaaacgtccgacgcgatcgcggaagtcaaggcgctgaccggcggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgaaactcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcattttcgaggagccgacgccgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctcgcgtacaacggc
gaattcgcggacgtgatccgcttcatcgcggacggccggatcgacgtgcagcccctcatc
accgggcgcatcgcgctcggcgacatcgtcgcgcacggcttcgaggaactggtcaaccac
aaggaccgcaacgtgaagatcatcgtccagcccgccgtgtcctga

DBGET integrated database retrieval system