KEGG   Burkholderia stabilis: BBJ41_26825Help
Entry
BBJ41_26825       CDS       T04946                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00250  Alanine, aspartate and glutamate metabolism
bstl00410  beta-Alanine metabolism
bstl00640  Propanoate metabolism
bstl00650  Butanoate metabolism
bstl01100  Metabolic pathways
bstl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BBJ41_26825
   00650 Butanoate metabolism
    BBJ41_26825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBJ41_26825
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBJ41_26825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bstl01007]
    BBJ41_26825
Enzymes [BR:bstl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BBJ41_26825
Amino acid related enzymes [BR:bstl01007]
 Aminotransferase (transaminase)
  Class III
   BBJ41_26825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOR72297
UniProt: A0A1D7ZQZ3
LinkDB All DBs
Position
2:2012756..2014039
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAISDQLNNFTHTAYQIVPYASYVELAEKINARAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVSTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFYAAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCDRATQLGDVLKAKLNSLQADVPQIADVRGPGAMIAVEFLK
PGSGEPDADFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPEAVFNEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgcagcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatctcggatcagctgaacaatttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggccgagaagatcaacgcgcgcgcgccgggcgatttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatcaagatc
gcgcgcgccgcgaccggccgtccgggcgtcatcgccttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcaccgtacccgaacgcgctgcacggcgtgagcacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgttgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttctacgcggcgccggcggaattc
gtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgacgaagtc
cagaccggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcaaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacctgatggacgcggcagcacccggcggcctcggcggcacgtacgcgggcaac
ccgctggcggttgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gaccgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaactcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcctgaag
ccgggctcgggcgagccggatgcggacttcacgaagcgcgtgcaaacgcgtgcgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgattcccgaggccgtgttcaacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system